Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G22630-AT4G37940
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):AGAMOUS-like 17
Function (paralog2):AGAMOUS-like 21

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.17248517103051
Log2 mRNA fold difference:0.79531331024626
Log2 TE fold difference:-0.74443398273643
Sequences
Protein sequence

MGRGKIVIQKIDDSTSRQVTFSKRRKGLIKKAKELAILCDAEVCLIIFSNTDKLYDFASS
SVKSTIERFNTAKMEEQELMNPASEVKFWQREAETLRQELHSLQENYRQLTGVELNGLSV
KELQNIESQLEMSLRGIRMKREQILTNEIKELTRKRNLVHHENLELSRKVQRIHQENVEL
YKKAYGTSNTNGLGHHELVDAVYESHAQVRLQLSQPEQSHYKTSSNS

MGRGKIVIQRIDDSTSRQVTFSKRRKGLIKKAKELAILCDAEVGLIIFSSTGKLYDFASS
SMKSVIDRYNKSKIEQQQLLNPASEVKFWQREAAVLRQELHALQENHRQMMGEQLNGLSV
NELNSLENQIEISLRGIRMRKEQLLTQEIQELSQKRNLIHQENLDLSRKVQRIHQENVEL
YKKAYMANTNGFTHREVAVADDESHTQIRLQLSQPEHSDYDTPPRANE

www.000webhost.com

Other information
Ka divergence:-0.236972KaKs divergence:0.194634
GC content 1 (%):40GC content 2 (%):42GC content divergence:0.024
Length 1 (bp):684Length 2 (bp):687Length divergence:0.002
MFE 1 (kcal):-177.7MFE 2 (kcal):-180.3MFE divergence0.007