Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G22660-AT4G37900
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (duplicated DUF1399)
Function (paralog2):Protein of unknown function (duplicated DUF1399)

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-3.587414139176
Log2 mRNA fold difference:-4.2061223508763
Log2 TE fold difference:0.67667856115251
Sequences
Protein sequence

MDKEKDHEVEWLEAQKIEISVDLLAAAKQHLLFLETVDRNRWLYDGPALEKAIYRYNACW
LPLLVKYSESSSVSEGSLVPPLDCEWIWHCHRLNPVRYNSDCEQFYGRVLDNSGVLSSVD
GNCKLKTEDLWKRLYPDEPYELDLDNIDLEDISEKSSALEKCTKYDLVSAVKRQSPFYYQ
VSRSHVNSDIFLQEAVARYKGFLYLIKMNRERSLKRFCVPTYDVDLIWHTHQLHPVSYCD
DMVKLIGKVLEHDDTDSDRGKGKKLDTGFSKTTAQWEETFGTRYWKAGAMHRGKTPVPVT
NSPYASDVLVKDPTAKDDFQNLIQFPEVEVVEVLLEIIGVRNLPDGHKGKVSVMFSKTQP
DSLFNAERRLTILSEVGEKQVATFQCEPTGELVFKLISCSPSKIPVSREPKNLGFASLSL
KEFLFPVITQLSVEKWLELTPSKGSQTDTKPISLRVAVSFTPPVRSPSVLHMVQSRPSCK
GSCFFPIIGKSRLAKSSTHIVDETQTEVITLQIRNSADGGILKDDQRQVMGVTDSGETRV
LAVYTGSFWSLLDSKWSLKQINASTADNPLFEILGPRVVKIFSGRKLDYEPKHCANLRSD
LDFMTLVEFSKQHPYGKTVGLVDMRFGSIEAKENWLLLPGIVSAFILHTVLKKGGSEGFN
VTTKDIKEESKQTKLVAATENNVNANSTNVETQTAITAPKKGSGCGGGCSGECGNMVKAA
NASGCGSSCSGECGDMVKSAANASGCGSGCSGECGNMVKAANASGGGYGARCKAAKASGC
GGGCGGGCGGGCGDMVKSVNASGCGGGCNGECGNMVKAA

MDKEKEQTLEWNEAQKIDISVDLLAAAKKHLLFLGAVDRNRCLYDGPALQRAIYRYNAYW
LPLLAQYTESSSICQGPLVPPLDCEWVWHCHRLNPVRYKTDCEQFYGRVLDNSGVVSSVN
GNCKSQTETLWKRLYPTEPYDLDFANAISEPADVSALEKCTTYDLVLAVKRQSPFFYQVS
RAHVDNDVFLQEAVARYKAFLYLIKGNRERSIKLFCVPTYDIDLIWHTHQLHAISYCNDL
TKMIGKVLEHDDTDSDRSKGKKLDTGFSGTTAQWEETFGRRYWKAGAMNRGNTPKPVTTS
PYVCSGKKSIAKEEESQNVIQYPEVKVIEVILEIVGVKNLPDAHKGKVFVLFSKTQPDSL
FNAERRLTVLSESCGEKQVALFQCEPTGELSFQLMSSKSKSLGFTSLSFSEFLSPVTKLS
VEKWLELTPTKRGKADDPNPISLRVAVSFTPPTRSPTVLHLVQARPSLKGSCFLPMLRKV
RLAKSFTRVVDETETEVINLQMRNSNDAAPKGDRRQVIGVKECGETYVLAEYDGTFWSLL
DSKWSLKQTCNPATDGPLFELSGTRMVKVYSGRKLEYEPKHCSKLRSEQDFMTAVEFSKQ
HPYGKAVGLLDLKFGSIEANEKWLVLPGMVSSFILSDLLKKEGFSAAAKDTVKANGITEE
STEIDVLSQEKLEEETMMDVDTTTPVAVAAEKINGGARCFSKELSGNMIEEEGGHCGGCG
GCGGCGGGGGCGGGGRCGGMTKIEGCGGGSCTGGSTGCGNCGGGCGNMMKNNANGNAPSV
ENDAVTA

www.000webhost.com

Other information
Ka divergence:0.100021KaKs divergence:-0.150884
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):2460Length 2 (bp):2364Length divergence:-0.02
MFE 1 (kcal):-784.88MFE 2 (kcal):-726.12MFE divergence-0.039