Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G22680-AT4G37890
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Zinc finger (C3HC4-type RING finger) family protein
Function (paralog2):Zinc finger (C3HC4-type RING finger) family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.18107482949414
Log2 mRNA fold difference:-0.32882425385268
Log2 TE fold difference:0.50790013361044
Sequences
Protein sequence

MLNGWRRAFCTSIPKETNQNDVDDDGLVGLRHKSTSRFGFFSTPSTPRSDSGTGTYSLRC
RTSTATAVSTTSSLPGTPKLKCKTTTTGETTPRNRSLVSLLTPSSSSISPASFTLLKSKL
RFKQSSSNKCGICLQSVKSGQGTAIFTAECSHTFHFPCVTSRAAANHNRLASCPVCGSSL
LPEIRNYAKPESQIKPEIKNKSLRVYNDDEALISSPISPAGFHTILESDENEDCEEFTGF
SVNTPSPLTAKLLTDRNVDVKLSPESAIVASGKGYETYSVVMKVKSPPFPTARGFARRVP
VDLVAVLDVSGRNSGGKLEMLKQTMRIVLSNLREMDRLSIIAFSSSSKRLSPLRRMTANG
RRSARRIVDIITVPGSVSGVGIDFSGEGMSVNDALKKAVKVLDDRRQKNPFTAVFVLTDR
QAHQVAQLAHSRIPIHTIWLSHAIPEDAFARTINGYLSLSVQDLGLQLGIVSGLGQGEIT
SVYSLSGRPAWLGTGSIRLGDMYAEEERALLVEIKSPVNNSLTGSRSHKIMTVRSRYVDP
TTQELRNPEDRALLIPTPLTVRSSSNPNISRLRNLHVSTRAVAESRRLIERNHYSGAHRL
LTSARALLVQHGLSSSDACIRGLDAEIADLNSVKGRHVAASESLESLTPTSAWKAAERLA
KVAMVRKHMNRVSDLHGFENARF

MMNGLRRTFWSSIHKKKDNNRVDDSLDRQKPTTTSRFGFFSNPSTPRSETRPDSVTCSPT
IPCQSWSATAISTPSPSLPASPKLQCDTSGDVTPTRNRSPLSFLSVSSSSSTPSSPKSPA
SFSLLKSKLCFTKVRILNRNNQVNIFKNNSKLTFLRLCYEQSSISSSKCGICLQSAKAGR
GTAIFTAECSHTFHFPCVASRAGDRNLLSDCPVCGASWRETSLLPLSLSSSLHESGSESD
SKIRESKNNNKSLRVYNDDEPLISSPISRTGFNTIPESNEDEEEEDNDDGEFKGFYVNTP
SPLTTKKMLTDSVTGHVDVKLSSEAAIVAVGRGNETYSVLMKIKSPSLPTARRSPVDLVT
VIDVSGGNIEMVKRAMRQVISSLRETDRLSMVSFSSSSKRLTPLRRMTANGRRLARRIVD
DISGDGDGMSVNDAVKKAAKVIEDRRQKNLFTTIFVLTDRNRNSAHQAQLAQPDFVTSTR
FSHLEIPTHTIWLGACNHALPEDVFAKRIKSLLSLSVQDLTLNLGLVSGSGQGKVTSVYS
LSGRPVWLGSGLIRLGDMYGDEEREVLVELKSPSSSRSQRIMTVRSRHVDPTTQEIKNYE
DRALMIPRPTTVRSSDPSIARLRNLHVSTRAVAESRRLVEVNDYSGAERMLTSARALLVQ
YGLSSSDSCLRGLEAELADLNRLRGRHVAVKSPEPVVQKSEPLTPTSAWRAAERLAKVAI
MRKHMNRVSDLHGFENARF

www.000webhost.com

Other information
Ka divergence:-0.0968657KaKs divergence:0.157528
GC content 1 (%):49GC content 2 (%):47GC content divergence:-0.021
Length 1 (bp):2052Length 2 (bp):2220Length divergence:0.039
MFE 1 (kcal):-686.13MFE 2 (kcal):-709.32MFE divergence0.017