Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G22690-AT4G37880
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):zinc ion binding
Function (paralog2):LisH/CRA/RING-U-box domains-containing protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.4888169352448
Log2 mRNA fold difference:2.5542470077152
Log2 TE fold difference:-1.0339571480127
Sequences
Protein sequence

MELKNVKDAFDRVTKKQKLCYSKTHEVVDKMSQEIDKALKTIQEDNHESVVADLKKTFEE
IAPINLLEASQKEINGVLTKYPKALDKTLNPDISTAYRNVKFDTHTVHQILAQFFYRQGM
YDVGDCFISETGEVKPESSVTKAFMEMNMILEAMKERDLGPALKWVASNSDKLKEAKSDL
ELKLHSLHFLEIAKDKTSEEAINYARKHFATYSADSCCFPEIQKLMCSLLWIRNLNKSPY
SEFLSPVLWTNAAKELTRQYCILLGESPESPLSVTVAAGSQVLPTFLKYLNVLPEKRKEW
QTMEQLLVPVELSEEYRFYSVFVCPVSKEHSSEDNPPMRLACGHVLCKQSINRMSRNGSR
SFKCPYCPTDIDASQCKQLYF

MELKSIKDAFDRVATKQKLSYSKTNEIVHMLSQEIDKALSILEETPSSDTMLLDHRSILA
DVKKVFMEIAPITQLEATEKELHAALTKYPKVLEKQLNPDISKAYRHNVEFDTHIVNQII
ANFFYRQGMFDIGDCFVAETGESECSTRQSFVEMYRILEAMKRRDLEPALNWAVSNSDKL
KEARSDLEMKLHSLHFLEIARGKNSKEAIDYARKHIATFADSCLPEIQKLMCSLLWNRKL
DKSPYSEFLSPALWNNAVKELTRQYCNLLGESSESPLSITVTAGTQALPVLLKYMNVVMA
NKKLDWQTMEQLPVDAQLSEEFQFHSVFVCPVSKEQSSDDNPPMMMSCGHVLCKQTINKM
SKNGSKSSFKCPYCPTDVDISRCRQLHF

Other information
Ka divergence:-0.230872KaKs divergence:-0.217168
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):1146Length 2 (bp):1167Length divergence:0.009
MFE 1 (kcal):-303.9MFE 2 (kcal):-344.39MFE divergence0.062