Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G22750-AT4G37850
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):basic helix-loop-helix (bHLH) DNA-binding superfamily protein
Function (paralog2):basic helix-loop-helix (bHLH) DNA-binding superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.1449319916892
Log2 mRNA fold difference:1.4933676388679
Log2 TE fold difference:0.17997176642726
Sequences
Protein sequence

MNSLVGDVPQSLSSLDDTTTCYNLDASCNKSLVEERPSKILKTTHISPNLHPFSSSNPPP
PKHQPSSRILSFEKTGLHVMNHNSPNLIFSPKDEEIGLPEHKKAELIIRGTKRAQSLTRS
QSNAQDHILAERKRREKLTQRFVALSALIPGLKKMDKASVLGDAIKHIKYLQESVKEYEE
QKKEKTMESVVLVKKSSLVLDENHQPSSSSSSDGNRNSSSSNLPEIEVRVSGKDVLIKIL
CEKQKGNVIKIMGEIEKLGLSITNSNVLPFGPTFDISIIAQKNNNFDMKIEDVVKNLSFG
LSKLT

MSILSTRWFSEQEIEENSIIQQFHMNSIVGEVQEAQYIFPHSFTTNNDPSYDDLIEMKPP
KILETTYISPSSHLPPNSKPHHIHRHSSSRILSFEDYGSNDMEHEYSPTYLNSIFSPKLE
AQVQPHQKSDEFNRKGTKRAQPFSRNQSNAQDHIIAERKRREKLTQRFVALSALVPGLKK
MDKASVLGDALKHIKYLQERVGELEEQKKERRLESMVLVKKSKLILDDNNQSFSSSCEDG
FSDLDLPEIEVRFSDEDVLIKILCEKQKGHLAKIMAEIEKLHILITNSSVLNFGPTLDIT
IIAKKESDFDMTLMDVVKSLRSALSNFI

Other information
Ka divergence:-0.0100148KaKs divergence:-0.274995
GC content 1 (%):39GC content 2 (%):39GC content divergence:0
Length 1 (bp):918Length 2 (bp):987Length divergence:0.036
MFE 1 (kcal):-230.58MFE 2 (kcal):-259.5MFE divergence0.059