Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G22800-AT4G37790
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Homeobox-leucine zipper protein family
Function (paralog2):Homeobox-leucine zipper protein family

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:3.0624767599435
Log2 mRNA fold difference:3.4463708187363
Log2 TE fold difference:-0.61659492730964
Sequences
Protein sequence

MGFDDTCNTGLVLGLGPSPIPNNYNSTIRQSSVYKLEPSLTLCLSGDPSVTVVTGADQLC
RQTSSHSGVSSFSSGRVVKRERDGGEESPEEEEMTERVISDYHEDEEGISARKKLRLTKQ
QSALLEESFKDHSTLNPKQKQVLARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKC
CETLADENIRLQKEIQELKTLKLTQPFYMHMPASTLTKCPSCERIGGGGGGNGGGGGGSG
ATAVIVDGSTAKGAFSISSKPHFFNPFTNPSAAC

MGLDDSCNTGLVLGLGLSPTPNNYNHAIKKSSSTVDHRFIRLDPSLTLSLSGESYKIKTG
AGAGDQICRQTSSHSGISSFSSGRVKREREISGGDGEEEAEETTERVVCSRVSDDHDDEE
GVSARKKLRLTKQQSALLEDNFKLHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTKL
KQTEVDCEFLKKCCETLTDENRRLQKELQDLKALKLSQPFYMHMPAATLTMCPSCERLGG
GGVGGDTTAVDEETAKGAFSIVTKPRFYNPFTNPSAAC

www.000webhost.com

Other information
Ka divergence:-0.187328KaKs divergence:-0.681159
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):825Length 2 (bp):837Length divergence:0.007
MFE 1 (kcal):-259MFE 2 (kcal):-255.04MFE divergence-0.008