Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G22810-AT4G37770
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):1-aminocyclopropane-1-carboxylate synthase 4
Function (paralog2):1-amino-cyclopropane-1-carboxylate synthase 8

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.059834253162418
Log2 mRNA fold difference:-1.4109071349234
Log2 TE fold difference:1.5656105707236
Sequences
Protein sequence

MVQLSRKATCNSHGQVSSYFLGWEEYEKNPYDVTKNPQGIIQMGLAENQLCFDLLESWLA
QNTDAACFKRDGQSVFRELALFQDYHGLSSFKNAFADFMSENRGNRVSFDSNNLVLTAGA
TSANETLMFCLADPGDAFLLPTPYYPGFDRDLKWRTGVEIVPIQSSSTNGFRITKLALEE
AYEQAKKLDLNVKGILITNPSNPLGTTTTQTELNILFDFITKNKNIHLVSDEIYSGTVFN
SSEFISVMEILKNNQLENTDVLNRVHIVCSLSKDLGLPGFRVGAIYSNDKDVISAATKMS
SFGLVSSQTQYLLSSLLSDKKFTKNYLRENQKRLKNRQRKLVLGLEAIGIKCLKSNAGLF
CWVDMRPLLRSKTFEAEMDLWKKIVYEVKLNISPGSSCHCEEPGWFRVCFANMIDETLKL
ALKRLKMLVDDENSSRRCQKSKSERLNGSRKKTMSNVSNWVFRLSFHDREAEER

MGLLSKKASCNTHGQDSSYFWGWEEYEKNPYDEIKNPDGIIQMGLAENQLSFDLIESWLA
KNPDAANFQREGQSIFRELALFQDYHGLPSFKNAMADFMSENRGNRVSFNPNKLVLTAGA
TPANETLMFCLADPGDAFLLPTPYYPGFDRDLKWRTGAEIVPIQCKSANGFRITKVALEE
AYEQAQKLNLKVKGVLITNPSNPLGTTTTRTELNHLLDFISRKKIHLISDEIYSGTVFTN
PGFISVMEVLKDRKLENTDVFDRVHIVYSLSKDLGLPGFRVGVIYSNDDFVVSAATKMSS
FGLISSQTQYLLSALLSDKTFTKNYLEENQIRLKNRHKKLVSGLEAAGIECLKSNAGLFC
WVDMRHLLKSNTFEAEIELWKKIVYEVKLNISPGSSCHCNEPGWFRVCFANLSEETLKVA
LDRLKRFVDGPSPTRRSQSEHQRLKNLRKMKVSNWVFRLSFHDREPEER

Other information
Ka divergence:-0.19081KaKs divergence:-0.568728
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1425Length 2 (bp):1410Length divergence:-0.005
MFE 1 (kcal):-411.21MFE 2 (kcal):-405.67MFE divergence-0.007