Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G22830-AT4G37760
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):squalene epoxidase 2
Function (paralog2):squalene epoxidase 3

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.9107938274862
Log2 mRNA fold difference:3.6628316699334
Log2 TE fold difference:-0.77802333105132
Sequences
Protein sequence

MKPFVIRNLPRFQSTLRSSLLYTNHRPSSRFSLSTRRFTTGATYIRRWKATAAQTLKLSA
VNSTVMMKPAKIALDQFIASLFTFLLLYILRRSSNKNKKNRGLVVSQNDTVSKNLETEVD
SGTDVIIVGAGVAGSALAHTLGKEGRRVHVIERDFSEQDRIVGELLQPGGYLKLIELGLE
DCVKKIDAQRVLGYVLFKDGKHTKLAYPLETFDSDVAGRSFHNGRFVQRMREKALTLSNV
RLEQGTVTSLLEEHGTIKGVRYRTKEGNEFRSFAPLTIVCDGCFSNLRRSLCKPKVDVPS
TFVGLVLENCELPFANHGHVVLGDPSPILMYPISSSEVRCLVDVPGQKLPPIANGEMAKY
LKTRVAPQVPTKVREAFITAVEKGNIRTMPNRSMPADPIPTPGALLLGDAFNMRHPLTGG
GMTVALADIVVLRDLLRPIRNLNDKEALSKYIESFYTLRKPVASTINTLADALYKVFLAS
SDEARTEMREACFDYLSLGGVFSSGPVALLSGLNPRPLSLVLHFFAVAIYAVCRLMLPFP
SIESFWLGARIISSASSIIFPIIKAEGVRQMFFPRTIPAIYRAPP

MAPTIFVDHCILTTTFVASLFAFLLLYVLRRRSKTIHGSVNVRNGTLTVKSGTDVDIIIV
GAGVAGAALAHTLGKEGRRVHVIERDLTEPDRIVGELLQPGGYLKLIELGLEDCVKDIDA
QRVLGYALFKDGKHTKLSYPLDQFDSDVAGRSFHNGRFVQRMREKASLLPNVRMEQGTVT
SLVEENGIIKGVQYKTKDGQELKSFAPLTIVCDGCFSNLRRSLCKPKVEVPSNFVGLVLE
NCELPFPNHGHVVLGDPSPILFYPISSSEVRCLVDVPGSKLPSVASGEMAHHLKTMVAPQ
VPPQIRDAFISAVEKGNIRTMPNRSMPADPIHTPGALLLGDAFNMRHPLTGGGMTVALSD
IVILRDLLNPLVDLTNKESLSKYIESFYTLRKPVASTINTLAGALYKVFLASPDDARSEM
RRACFDYLSLGGVCSSGPVALLSGLNPRPMSLVLHFFAVAIFGVGRLLVPLPSVKRLWLG
ARLISSASGIIFPIIKAEGVRQMFFPRTIPAIYRAPPTPSSSSPQ

Other information
Ka divergence:-0.103126KaKs divergence:-0.28118
GC content 1 (%):44GC content 2 (%):46GC content divergence:0.022
Length 1 (bp):1758Length 2 (bp):1578Length divergence:-0.054
MFE 1 (kcal):-523.03MFE 2 (kcal):-485.59MFE divergence-0.037