Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G22850-AT4G37730
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):basic leucine-zipper 6
Function (paralog2):basic leucine-zipper 7

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.3064939773475
Log2 mRNA fold difference:-1.5011318939728
Log2 TE fold difference:1.7930725550471
Sequences
Protein sequence

MMSTVPAFTFTEPGLVNQLSDFQTGFTPWELNCSDLFSTIHLEPVVPSPCSGESDAGSVK
INTDFNGFDESCIGSIKTNSGSDDSNLFHGVPSPQSDELDSKNTKIRSNATNHNRNKLNR
SVLQVTDDRKRKRMESNRESAKRSRMRKQRHIDNLKDEANRLGLENRELANRLRIVLYNI
ALMCTDNNQLLSEQEILRRRFLEMRQILIFRQLQLNPSLIINHHHMI

MTQKLFIQYSLRSYIVFWKYDQITPWFVHKYQAPTMQFFPFPLLISLISLLEKLLAIMLS
TAPAFSFSEPGLVNQFSGFQTGFTPWEWDCSDLFFVDQMSLEPAIPSPCYGESDTGSVKI
NSGSHDMKTGSDESCAGFVKINPRCDDADISNDLPCSQADEPDSDDTKQLTAITNFGSGE
NNHNRKKMIQPEMTDERKRKRMESNRESAKRSRMRKQSHIDNLREQVNRLDLENRELGNR
LRLVLHQLQRVNSDNNRLVTEQEILRLRLSEMRRILIIRQLQQQQQWELHNRRMIMTEQN
HPHLQ

Other information
Ka divergence:0.291618KaKs divergence:0.559022
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):684Length 2 (bp):918Length divergence:0.146
MFE 1 (kcal):-204.81MFE 2 (kcal):-257.4MFE divergence0.114