Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G22880-AT4G37710
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):VQ motif-containing protein
Function (paralog2):VQ motif-containing protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.5362137452062
Log2 mRNA fold difference:-1.4960767029659
Log2 TE fold difference:-0.032640636335522
Sequences
Protein sequence

MEATSQPCFSHNSSLHSTRKQPAKPWKKPVTGLPQRMHPKVYRVEPVNFKELVQRLTGAE
DVEQEVHQVEAKPVKISDDTTTAKDNPFAFDLSPSSSRFWEAFPLLSPANLSRW

MEATSQQFMSQSYLNAQETTTRATKNYLTSLHSTRKQPSKPLKRPAISSPLNPMHPHVYR
VEPVNFKVLVQRLTGAPEHETVQAKPLKTSDDAAKQSSSSFAFDPSSSWGDFSFQNPANI
SRW

Other information
Ka divergence:0.33987KaKs divergence:0.834956
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):345Length 2 (bp):372Length divergence:0.038
MFE 1 (kcal):-92.14MFE 2 (kcal):-93.2MFE divergence0.006