Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G22910-AT4G37670
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):N-acetyl-l-glutamate synthase 1
Function (paralog2):N-acetyl-l-glutamate synthase 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.7831504864458
Log2 mRNA fold difference:-1.6522130814363
Log2 TE fold difference:-0.1625169574017
Sequences
Protein sequence

MTERGAMVVSSSTCYVPFRCPQARKDFAFVEPSKKLNPNRVLIKPPVYTYSPALTAAKCN
IFDYAETGENLVGDKQFVRWFREAWPYLWAHRSCTFVVTISGDVLDGPYCDLVLKDIAFL
HHLGIKFVLVPGTQVQIDQLLAERGREPTYVGRYRVTDSASLQAAKEAAGAISVMIEAKL
SPGPSIYNIRRHGDSSRLHETGVRVDTGNFFAAKRRGVVDGVDFGATGLVKKIDVDRIRE
RLDSGSVVLLRNLGHSSTGEVLNCNTYEVATACALAIGADKLICIMDGPVLDENGHLVRF
LTLQEADTLVRKRAQQSEIAANYVKAVGDGGISSFPEPLGYNGMVTTPNNHIGRPIWEKL
SPTFQNGVGFDNGNGLWSGEQGFAIGGEERISRLNGYLSELAAAAFVCRGGVKRVHLLDG
TISGVLLLELFKRDGMGTMVASDVYEGNREAKVEDLAGIRQIIKPLEESGALVRRTDEEL
LRALDSFVVVEREGHIIACAALFPFFEEKCGEVAAIAVASDCRGQGQGDKLLDYIEKKAS
ALGLEMLFLLTTRTADWFVRRGFQECPIEMIPEARRERINLSRRSKYYMKKLLPDRSGIS
VVRTFQYDS

MERGALVGSSSTSSYYVPYHFRQSKSNFSSFKPKNKLNPTQFRFNCSWFKPVSSITAAKC
NMFDYAVTAAGDVEAEHPVDDKQFVRWFREAWPYLWAHRGCTFVVIISGEIIAGSSCDAI
LKDIAFLHHLGIRFVLVPGTQEQIDQLLAERGREATYVGRYRVTDAASLQAAKEAAGAIS
VMLEAKLSPGPSICNIRRHGDRSRLHDIGVRVDTGNFFAAKRRGVVDGVDFGATGEVKKI
DVDRICERLDGGSVVLLRNLGHSSSGEVLNCNTYEVATACALAIGADKLICIMDGPILDE
SGHLIHFLTLQEADMLVRKRAQQSDIAANYVKAVGDGSMAYPEPPNNTNGNITSAQNGRA
VSFWGNGNHTPIFQNGVGFDNGNGLWPCEQGFAIGGEERLSRLNGYLSELAAAAFVCRGG
VKRVHLLDGTISGVLLLELFKRDGMGTMVASDVYEGTRDARVEDLAGIRHIIKPLEESGI
LVRRTDEELLRALDSFVVVEREGQIIACAALFPFFKDKCGEVAAIAVASDCRGQGQGDKL
LDYIEKKASSLGLEKLFLLTTRTADWFVRRGFQECSIEIIPESRRQRINLSRNSKYYMKK
LIPDRSGISVMRI

Other information
Ka divergence:0.21261KaKs divergence:-0.103131
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1830Length 2 (bp):1842Length divergence:0.003
MFE 1 (kcal):-585.92MFE 2 (kcal):-594.21MFE divergence0.007