Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G22950-AT4G37640
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Cation transporter/ E1-E2 ATPase family protein
Function (paralog2):calcium ATPase 2

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:5.8111144906643
Log2 mRNA fold difference:5.7619610363658
Log2 TE fold difference:0.066978469006188
Sequences
Protein sequence

MESYLNSNFDVKAKHSSEEVLEKWRNLCSVVKNPKRRFRFTANLSKRYEAAAMRRTNQEK
LRIAVLVSKAAFQFISGVSPSDYKVPEEVKAAGFDICADELGSIVEGHDVKKLKFHGGVD
GLSGKLKACPNAGLSTGEPEQLSKRQELFGINKFAESELRSFWVFVWEALQDMTLMILGV
CAFVSLIVGIATEGWPQGSHDGLGIVASILLVVFVTATSDYRQSLQFRDLDKEKKKITVQ
VTRNGFRQKMSIYDLLPGDVVHLAIGDQVPADGLFLSGFSVVIDESSLTGESEPVMVTAQ
NPFLLSGTKVQDGSCKMLVTTVGMRTQWGKLMATLSEGGDDETPLQVKLNGVATIIGKIG
LSFAIVTFAVLVQGMFMRKLSLGPHWWWSGDDALELLEYFAIAVTIVVVAVPEGLPLAVT
LSLAFAMKKMMNDKALVRHLAACETMGSATTICSDKTGTLTTNHMTVVKSCICMNVQDVA
SKSSSLQSDIPEAALKLLLQLIFNNTGGEVVVNERGKTEILGTPTETAILELGLSLGGKF
QEERQSNKVIKVEPFNSTKKRMGVVIELPEGGRIRAHTKGASEIVLAACDKVINSSGEVV
PLDDESIKFLNVTIDEFANEALRTLCLAYMDIESGFSADEGIPEKGFTCIGIVGIKDPVR
PGVRESVELCRRAGIMVRMVTGDNINTAKAIARECGILTDDGIAIEGPVFREKNQEEMLE
LIPKIQVMARSSPMDKHTLVKQLRTTFDEVVAVTGDGTNDAPALHEADIGLAMGIAGTEV
AKEIADVIILDDNFSTIVTVAKWGRSVYINIQKFVQFQLTVNVVALIVNFSSACLTGSAP
LTAVQLLWVNMIMDTLGALALATEPPNNELMKRMPVGRRGNFITNAMWRNILGQAVYQFI
IIWILQAKGKSMFGLVGSDSTLVLNTLIFNCFVFCQVFNEVSSREMEEIDVFKGILDNYV
FVVVIGATVFFQIIIIEFLGTFASTTPLTIVQWFFSIFVGFLGMPIAAGLKKIPV

MESYLNENFDVKAKHSSEEVLEKWRNLCGVVKNPKRRFRFTANLSKRYEAAAMRRTNQEK
LRIAVLVSKAAFQFISGVSPSDYTVPEDVKAAGFEICADELGSIVESHDVKKLKFHGGVD
GLAGKLKASPTDGLSTEAAQLSQRQELFGINKFAESEMRGFWVFVWEALQDMTLMILGVC
AFVSLIVGIATEGWPKGSHDGLGIAASILLVVFVTATSDYRQSLQFRDLDKEKKKITVQV
TRNGFRQKLSIYDLLPGDIVHLAIGDQVPADGLFLSGFSVVIDESSLTGESEPVMVNAQN
PFLMSGTKVQDGSCKMMITTVGMRTQWGKLMATLTEGGDDETPLQVKLNGVATIIGKIGL
FFAVVTFAVLVQGMFMRKLSTGTHWVWSGDEALELLEYFAIAVTIVVVAVPEGLPLAVTL
SLAFAMKKMMNDKALVRHLAACETMGSATTICSDKTGTLTTNHMTVVKSCICMNVQDVAN
KGSSLQSEIPESAVKLLIQSIFNNTGGEVVVNKHGKTELLGTPTETAILELGLSLGGKFQ
EERKSYKVIKVEPFNSTKKRMGVVIELPEGGRMRAHTKGASEIVLAACDKVVNSSGEVVP
LDEESIKYLNVTINEFANEALRTLCLAYMDIEGGFSPDDAIPASGFTCVGIVGIKDPVRP
GVKESVELCRRAGITVRMVTGDNINTAKAIARECGILTDDGIAIEGPVFREKNQEELLEL
IPKIQVMARSSPMDKHTLVKQLRTTFDEVVAVTGDGTNDAPALHEADIGLAMGIAGTEVA
KESADVIILDDNFSTIVTVAKWGRSVYINIQKFVQFQLTVNVVALVVNFSSACLTGSAPL
TAVQLLWVNMIMDTLGALALATEPPNDELMKRLPVGRRGNFITNAMWRNILGQAVYQFIV
IWILQAKGKAMFGLDGPDSTLMLNTLIFNCFVFCQVFNEISSREMEEIDVFKGILDNYVF
VVVIGATVFFQIIIIEFLGTFASTTPLTITQWIFSIFIGFLGMPIAAGLKTIPV

www.000webhost.com

Other information
Ka divergence:-0.29129KaKs divergence:-0.334928
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):3048Length 2 (bp):3045Length divergence:0
MFE 1 (kcal):-951.14MFE 2 (kcal):-969.36MFE divergence0.009