Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G23050-AT4G37590
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Phototropic-responsive NPH3 family protein
Function (paralog2):Phototropic-responsive NPH3 family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:3.1986623538914
Log2 mRNA fold difference:2.8582535347475
Log2 TE fold difference:0.40813811085261
Sequences
Protein sequence

MKFMKLGTKPDSFLSKGDNVRYVTNELETEIIIIIGNVKFYLHKFPLLSKSGFLQKHIAT
SKNEEEKKNQIDEIDISEIPGGSVAFEICVKFCYGITVTLNAYNVVAVRCAAEFLEMNET
FEKSNLVYKIDVFLNSTIFRSWKDSIIVLQTTKDLLSDDSEELVKRCLGSIASTASIDTS
KVKWSYTYNRKKKLEKVRKPEDGVPKDWWVEDLCELHIDLYKQAIKAIKNRGKVPSNVIG
EALHAYAIRRIAGFSKESMQLIDRSLINTIIELLPDEKGNISSSFLTKLHRASIFLGCEE
TVKEKLKKRVSEQLEETTVNDILMYDLDMVQSLVKEFMNRDPKTHSKVSVAKLIDGYLAE
KSRDPNLPLQNFLSLAETLSSFPRHSHDVLYRAIDMFLKEHSGISKSEKKRVCGLMDCRK
LSAEACEHAVQNERLPMRVIVQVLFFEQIRANGSSTGYSTPELTTTTLNTEDDEWDHEKE
F

MKFMKLGSKPDSFQSEGDNVRYVSSELATDVIVIIGDVKFYLHKFPLLSKSARLQKLITT
STSSSNEENQIHHHHHEDEIEIAEIPGGPASFEICAKFCYGMTVTLNAYNVVAARCAAEF
LEMYETVEKGNLVYKIEVFLNSSILQSWKDSIIVLQTTRALSPYSEELKLTGRCLDSIAS
RASIDTSKVEWSYTYSKKKNLDNGLRKPQAVPRDWWVEDLCDLHIDLYKRALATIEARGN
VSADVIGEALHAYAIKRIPGFSKSSSVQVTDFAKYRALADSIIELIPDEKRSVSSSFLTK
LLRASIFLGCDEVAGLKNRVGERLDEANLGDVLLYDVELMQSLVEVFLKSRDPREDDVTA
KASVAKLVDGYLAEKSRDSDNLPLQKFLSLAEMVSSFPRQSHDGVYRAIDMFLKEHPEMN
KSEKKRICRLMDCRKLSAEACAHAVQNERLPMRVVVQVLFFEQVRANNNGSSSTGNSTPE
VIPASRSTNTTDQEDTECWDTEDIKALRGELANLRLAKNQQESHNQGKLMKGGGLGVSRV
FSKLWSGKERSGDMISSSGTSSPGSVNDDSKSSSSTSKKH

www.000webhost.com

Other information
Ka divergence:-0.153741KaKs divergence:-0.125
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):1446Length 2 (bp):1743Length divergence:0.093
MFE 1 (kcal):-413.1MFE 2 (kcal):-528.24MFE divergence0.122