Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G23070-AT2G23080
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.259612437791
Log2 mRNA fold difference:-2.6802287879121
Log2 TE fold difference:0.47250654520165
Sequences
Protein sequence

MALRPCTGFTISSLRNASAANNNLFSLLSFSSSSPAKRNLLLSSLQDNLRRFASSASLYR
QHLRNQQQQHQQQQQSRVKEKSETLAQKIGKSIRRAGAPSKARVYADVNVVRPKDYWDYE
SLAVQWGVQDDYEVVRKVGRGKYSEVFEGIHATDNEKCVIKILKPVKKKKIKREIKILQN
LCGGPNIVKLLDIVRDQQSKTPSLIFEHVNNKDFKVLYPTLSDYDVRYYIFELLKALDFC
HSRGIMHRDVKPHNVMIDHEQRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQ
DYDYSLDLWSLGCMFAGMIFRKEPFFYGHDNYDQLVKIAKVLGTDELNAYLNKYRIELDP
NLTSLVGRHSRKPWTKFINSENQHLAVPEAVDFVDKLLRYDHQERPTAKEAMAHPYFYPI
RNAESSRTPRSQ

MSKARVYTDVNVVRPKEYWDYESLVVQWGHQDDYEVVRKVGRGKYSEVFEGKNVNTNERC
VIKILKPVKKKKIKREIKILQNLCGGPNIVKLYDIVRDEHSKTPSLVFEFVNSVDFKVLY
PTLTDYDIRYYIYELLKALDFCHSQGIMHRDVKPHNVMIDHQLRKLRLIDWGLAEFYHPG
KEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKI
AKVLGTNELDHYLNKYQLDLDPQLEALVGRHVPKPWSKFINADNQHLVSPEAIDFLDKLL
QYDHQDRLTAREAMDHPYFAQVKAAESSRLRTQ

Other information
Ka divergence:0.469553KaKs divergence:0.387255
GC content 1 (%):44GC content 2 (%):40GC content divergence:-0.048
Length 1 (bp):1299Length 2 (bp):1002Length divergence:-0.129
MFE 1 (kcal):-414.8MFE 2 (kcal):-282.86MFE divergence-0.189