Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G23170-AT4G37390
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Auxin-responsive GH3 family protein
Function (paralog2):Auxin-responsive GH3 family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.7764768217477
Log2 mRNA fold difference:2.6679833812861
Log2 TE fold difference:-0.86215750365834
Sequences
Protein sequence

MTVDSALRSPMMHSPSTKDVKALRFIEEMTRNVDFVQKKVIREILSRNSDTEYLKRFGLK
GFTDRKTFKTKVPVVIYDDLKPEIQRIANGDRSMILSSYPITEFLTSSGTSAGERKLMPT
IDEDMDRRQLLYSLLMPVMNLYVPGLDKGKALYFLFVKTESKTPGGLPARPVLTSYYKSE
QFKRRPNDPYNVYTSPNEAILCPDSSQSMYTQMLCGLLMRHEVLRLGAVFASGLLRAIGF
LQTNWKELADDISTGTLSSRISDPAIKESMSKILTKPDQELADFITSVCGQDNSWEGIIT
KIWPNTKYLDVIVTGAMAQYIPMLEYYSGGLPMACTMYASSESYFGINLKPMCKPSEVSY
TIMPNMAYFEFLPHHEVPTEKSELVELADVEVGKEYELVITTYAGLNRYRVGDILQVTGF
YNSAPQFKFVRRKNVLLSIESDKTDEAELQSAVENASLLLGEQGTRVIEYTSYAETKTIP
GHYVIYWELLVKDQTNPPNDEVMARCCLEMEESLNSVYRQSRVADKSIGPLEIRVVKNGT
FEELMDYAISRGASINQYKVPRCVSFTPIMELLDSRVVSTHFSPALPHWSPERRR

MAVDSPLQSRMVSATTSEKDVKALKFIEEMTRNPDSVQEKVLGEILTRNSNTEYLKRFDL
DGVVDRKTFKSKVPVVTYEDLKPEIQRISNGDCSPILSSHPITEFLTSSGTSAGERKLMP
TIEEDLDRRQLLYSLLMPVMNLYVPGLDKGKGLYFLFVKSESKTSGGLPARPVLTSYYKS
DHFKRRPYDPYNVYTSPNEAILCSDSSQSMYAQMLCGLLMRHEVLRLGAVFASGLLRAIS
FLQNNWKELARDISTGTLSSRIFDPAIKNRMSKILTKPDQELAEFLVGVCSQENWEGIIT
KIWPNTKYLDVIVTGAMAQYIPTLEYYSGGLPMACTMYASSESYFGINLKPMCKPSEVSY
TIMPNMAYFEFLPHNHDGDGAAEASLDETSLVELANVEVGKEYELVITTYAGLYRYRVGD
ILRVTGFHNSAPQFKFIRRKNVLLSVESDKTDEAELQKAVENASRLFAEQGTRVIEYTSY
AETKTIPGHYVIYWELLGRDQSNALMSEEVMAKCCLEMEESLNSVYRQSRVADKSIGPLE
IRVVRNGTFEELMDYAISRGASINQYKVPRCVSFTPIMELLDSRVVSAHFSPSLPHWSPE
RRR

www.000webhost.com

Other information
Ka divergence:-0.097985KaKs divergence:0.286049
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1788Length 2 (bp):1812Length divergence:0.007
MFE 1 (kcal):-580.72MFE 2 (kcal):-585.12MFE divergence0.004