Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G23270-AT4G37290
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.610288267068
Log2 mRNA fold difference:-0.68091229795382
Log2 TE fold difference:-1.5729036679003
Sequences
Protein sequence

MMMNKVVLGSFLFFMLVSSNFVVEARPLGLTKAEENLVAKFFDGLSLGAIKESGPSSGGE
GHRFVDRTETLEYGKHSGPSTSGPGH

MMMNKNVLSSILFFMLIGSVLVESRPLGLTKTEEKFVASLFDGLSLGSIKDSGPSPGEGH
KVVDRKDTFRFVKHSGPSPSGPGH

Other information
Ka divergence:0.267561KaKs divergence:0.999804
GC content 1 (%):49GC content 2 (%):47GC content divergence:-0.021
Length 1 (bp):261Length 2 (bp):255Length divergence:-0.012
MFE 1 (kcal):-80.44MFE 2 (kcal):-75.44MFE divergence-0.032