Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G23290-AT4G37260
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):myb domain protein 70
Function (paralog2):myb domain protein 73

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.0625232685915
Log2 mRNA fold difference:1.6532060120781
Log2 TE fold difference:-0.04647466855036
Sequences
Protein sequence

MSGSTRKEMDRIKGPWSPEEDDLLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
PEVEHRGFTAEEDDTIILAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSGGGGG
GEEGQSCDFGGNGGYDGNLTDEKPLKRRASGGGGVVVVTALSPTGSDVSEQSQSSGSVLP
VSSSCHVFKPTARAGGVVIESSSPEEEEKDPMTCLRLSLPWVNESTTPPELFPVKREEEE
EKEREISGLGGDFMTVVQEMIKTEVRSYMADLQLGNGGGAGGGASSCMVQGTNGRNVGFR
EFIGLGRIE

MSNPTRKNMERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
PEVEHRAFSQEEDETIIRAHARFGNKWATISRLLNGRTDNAIKNHWNSTLKRKCSVEGQS
CDFGGNGGYDGNLGEEQPLKRTASGGGGVSTGLYMSPGSPSGSDVSEQSSGGAHVFKPTV
RSEVTASSSGEDPPTYLSLSLPWTDETVRVNEPVQLNQNTVMDGGYTAELFPVRKEEQVE
VEEEEAKGISGGFGGEFMTVVQEMIRTEVRSYMADLQRGNVGGSSSGGGGGGSCMPQSVN
SRRVGFREFIVNQIGIGKME

Other information
Ka divergence:-0.338816KaKs divergence:-0.431539
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):930Length 2 (bp):963Length divergence:0.017
MFE 1 (kcal):-313.68MFE 2 (kcal):-326.2MFE divergence0.02