Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G23300-AT4G37250
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Leucine-rich repeat protein kinase family protein
Function (paralog2):Leucine-rich repeat protein kinase family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:3.0875571704812
Log2 mRNA fold difference:2.7178434753861
Log2 TE fold difference:0.33843298227101
Sequences
Protein sequence

MKTQSASPFFFVSFFFFFFFFSSLFLLSSALNSDGVLLLSFKYSVLLDPLSLLQSWNYDH
DNPCSWRGVLCNNDSRVVTLSLPNSNLVGSIPSDLGFLQNLQSLNLSNNSLNGSLPVEFF
AADKLRFLDLSNNLISGEIPVSIGGLHNLQTLNLSDNIFTGKLPANLASLGSLTEVSLKN
NYFSGEFPGGGWRSVQYLDISSNLINGSLPPDFSGDNLRYLNVSYNQISGEIPPNVGAGF
PQNATVDFSFNNLTGSIPDSPVYLNQKSISFSGNPGLCGGPTRNPCPIPSSPATVSPPTS
TPALAAIPKSIGSNRETEPNNNSNPRTGLRPGVIIGIIVGDIAGIGILALIFFYVYKYKN
NKTVEKKNNHSLEAHEAKDTTSLSPSSSTTTSSSSPEQSSRFAKWSCLRKNQETDETEEE
DEENQRSGEIGENKKGTLVTIDGGEKELEVETLLKASAYILGATGSSIMYKTVLEDGTVL
AVRRLGENGLSQQRRFKDFEAHIRAIGKLVHPNLVRLRGFYWGTDEKLVIYDFVPNGSLV
NARYRKGGSSPCHLPWETRLKIVKGLARGLAYLHDKKHVHGNLKPSNILLGQDMEPKIGD
FGLERLLAGDTSYNRASGSSRIFSSKRLTASSREFGTIGPTPSPSPSSVGPISPYCAPES
LRNLKPNPKWDVFGFGVILLELLTGKIVSIDEVGVGNGLTVEDGNRALIMADVAIRSELE
GKEDFLLGLFKLGYSCASQIPQKRPTMKEALVVFERYPISSSAKSPSYHYGHY

MRMELISVIFFFFCSVLSSSALNSDGLVLMKFKSSVLVDPLSLLQTWNYKHESPCSWRGI
SCNNDSKVLTLSLPNSQLLGSIPSDLGSLLTLQSLDLSNNSFNGPLPVSFFNARELRFLD
LSSNMISGEIPSAIGDLHNLLTLNLSDNALAGKLPTNLASLRNLTVVSLENNYFSGEIPG
GWRVVEFLDLSSNLINGSLPPDFGGYSLQYLNVSFNQISGEIPPEIGVNFPRNVTVDLSF
NNLTGPIPDSPVFLNQESNFFSGNPGLCGEPTRNPCLIPSSPSIVSEADVPTSTPAIAAI
PNTIGSNPVTDPNSQQTDPNPRTGLRPGVIIGIVVGDIAGIGILAVIFLYIYRCKKNKIV
DNNNNDKQRTETDTITLSTFSSSSSSPEESRRFRKWSCLRKDPETTPSEEEDEDDEDEES
GYNANQRSGDNKLVTVDGEKEMEIETLLKASAYILGATGSSIMYKAVLEDGRVFAVRRLG
ENGLSQRRFKDFEPHIRAIGKLVHPNLVRLCGFYWGTDEKLVIYDFVPNGSLVNPRYRKG
GGSSSPYHLPWETRLKIAKGIARGLAYLHEKKHVHGNLKPSNILLGHDMEPKIGDFGLER
LLTGETSYIRAGGSSRIFSSKRYTTSSREFSSIGPTPSPSPSSVGAMSPYCAPESFRSLK
PSPKWDVYGFGVILLELLTGKIVSVEEIVLGNGLTVEDGHRAVRMADVAIRGELDGKQEF
LLDCFKLGYSCASPVPQKRPTMKESLAVLERFHPNSSVIKSSSFHYGH

Other information
Ka divergence:0.0219858KaKs divergence:-0.253955
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):2322Length 2 (bp):2307Length divergence:-0.003
MFE 1 (kcal):-706.61MFE 2 (kcal):-741.39MFE divergence0.024