Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G23340-AT4G36900
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DREB and EAR motif protein 3
Function (paralog2):related to AP2 10

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.031467291920231
Log2 mRNA fold difference:-0.74470518356638
Log2 TE fold difference:1.0250045778966
Sequences
Protein sequence

METEAAVTATVTAATMGIGTRKRDLKPYKGIRMRKWGKWVAEIREPNKRSRIWLGSYATP
EAAARAYDTAVFYLRGPSARLNFPELLAGLTVSNGGGRGGDLSAAYIRRKAAEVGAQVDA
LGATVVVNTGGENRGDYEKIENCRKSGNGSLERVDLNKLPDPENSDGDDDECVKRR

METATEVATVVSTPAVTVAAVATRKRDKPYKGIRMRKWGKWVAEIREPNKRSRIWLGSYS
TPEAAARAYDTAVFYLRGPSARLNFPELLAGVTVTGGGGGGVNGGGDMSAAYIRRKAAEV
GAQVDALEAAGAGGNRHHHHHQHQRGNHDYVDNHSDYRINDDLMECSSKEGFKRCNGSLE
RVDLNKLPDPETSDDD

Other information
Ka divergence:-0.0174309KaKs divergence:0.457438
GC content 1 (%):51GC content 2 (%):51GC content divergence:0
Length 1 (bp):531Length 2 (bp):591Length divergence:0.053
MFE 1 (kcal):-162.89MFE 2 (kcal):-194MFE divergence0.087