Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G23420-AT4G36940
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):nicotinate phosphoribosyltransferase 2
Function (paralog2):nicotinate phosphoribosyltransferase 1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.30581116620969
Log2 mRNA fold difference:-0.36915542156708
Log2 TE fold difference:0.68075984576619
Sequences
Protein sequence

MEPKENGSELGQKIIDGPTNPMVTPLLNDLYQFTMAYAYWKAGKHNERSVFDLYFRKNPF
GGEYTVFAGLEECVKFLANFKLTDEEIDFVQECLPGSEEAFCDYLRGLDCSDVEVYAIPE
GSVVFPKVPLMRVEGPVGVVQLLETPFLNLVNFASLVATNAARHRFVAGKSKSLLEFGAR
RAQGPDGAISASKYCYLGGFDATSNVAAGKLFGIPLRGTHSHAYVSSFMSTDEIVDKVLR
SADGKTTCEDFVSHVQTWLKKIQYSPSLSGIFSETNQSELAAFTSYALAFPKTFLALVDT
YDVMKSGIPNFCAVALALNDFGYKALGIRLDSGDLAYLSREARNFFCTVERELKVPGFGK
MVVTASNDLNEETIDALNKQGHEVDAFGIGTYLVTCYSQAALGCVFKLVEINNQPRIKLS
EDVTKVSIPCKKRSYRLYGKEGYPLVDIMTGENEPPPKVGERLLCRHPFNESKRAYVVPQ
RVEELLKCYWRGSADEAREVLPPLKEIRDRCIKQLENMRPDHMRRLNPTPYKVSVSAKLY
DFIHFLWLNEAPVGELQ

MEKKENGLDGKQSGRVINGPTNPMVTPLLNDLYQFTMAYAYWKAGKQSERSVFDLYFRKN
PFGGEYTIFAGLEECIKFLANFNLTDEEIDFVRDSLPGCEEAFCDYLRGLDCSDIEVYAI
SEGSVVFPKVPLLRIEGPVAVVQLLETPFLNLINYASLVATNAARHRFVAGKSKLLLEFG
ARRAQGPDGAISASKYCYLGGFDATSNVAAGKLFGIPLRGTHSHAFVSSFMSLDEIVDKV
LRSSDGKSTCKDFICLVQTCLTKIQNSSSLQGIFSETNQSELAAFISYALAFPNSFLALV
DTYDVMKSGIPNFCAVALALNELGYKAVGIRLDSGDLAYLSTEVRKFFCAIERDLKVPDF
GKMIVTASNDLNEETVDALNKQGHEVDAFGIGTNLVTCYAQAALGCVFKLVEINNQPRIK
LSEDVTKVSIPCKKRTYRLFGKEGYPLVDIMTGENEPPPKVGERLLCRHPFNESKRAYVV
PQRVEELLKCYWRGNADEAREELEPLKELRNRCIKQLENMRPDHMRRLNPTPYKVSVSAK
LYDFIHFLWLNEAPVGELH

Other information
Ka divergence:0.109744KaKs divergence:0.104286
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):1674Length 2 (bp):1680Length divergence:0.002
MFE 1 (kcal):-495.6MFE 2 (kcal):-501.2MFE divergence0.006