Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G23520-AT4G37100
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Pyridoxal phosphate (PLP)-dependent transferases superfamily protein
Function (paralog2):Pyridoxal phosphate (PLP)-dependent transferases superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.28438114604976
Log2 mRNA fold difference:-0.5468089758891
Log2 TE fold difference:0.23374907708915
Sequences
Protein sequence

MHFPLWKQIHHCATLILDKSKSRRRDGSDSPIDVRRKASMLRKLYEDKLRDALEEASENG
SLFKSQDVENENQDESLGRSRSLARLHAQREFLRATALAAERAFESEDDIPELLEAFNKF
LTMYPKFETSEKVDQLRSDEYGHLLDSKVCLDYCGFGLFSYVQTLHYWDSCTFSLSEITA
NLSNHALYGGAEIGTVEHDLKTRIMDYLNIPESEYGLVFTGSRGSAFRLLAESYPFHTNK
RLLTMFDHESQSVNWMAQTAREKGAKAYNAWFKWPTLKLCSTDLKKRLSHKKRKKKDSAV
GLFVFPAQSRVTGSKYSYQWMALAQQNNWHVLLDAGSLGPKDMDSLGLSLFRPEFIITSF
YKVFGHDPTGFGCLLIKKSVMGNLQSQSGKTGSGIVKITPQYPLYLSDSIDGLDGLVGLE
DHDIGTNGDKPATTDAARRGAQMPVFSGAYTSAQVRDVFETDLLEDNASDRDGTSSTIFE
ENESVSVGELMKSPAFSEDESSDNSFWIDLGQSPLGSDSAGHLNHHKIASPLPPFWFTSK
RQSPKPVAKSYSSPMYDGKDVLSFDAAVMSVTQEINSTPSRNLRNSNNLQIQEIQEENCG
NIVYRAGSGFGSNGSSSKISSDMKDNAIRRETEGEFRLLGRRGTGGRLLGLEDEQPSRGT
RVSFNMDRVSHSLDQGEASLASVYDESDGENPNEDDWDRREPEIVCSHIDHVNMLGLNKT
TSRLRFLINWLVISLLQLKVPEPGSDGSSRYMNLVQIYGPKIKYERGAAVAFNVKDKSKG
FVSPEIVLKLAEREGVSLGIGILSHIRIMDLPRNHRGGARIKEDSSLHLQREAGKRGGKN
GFVRFEVVTASLSFLSNFEDVYKLWAFVAKFLNPGFSREGSLPTVIEEEAEDSET

MHFSLWKQIHHCASLILDKSKSSRRRRDGSDSSLNVKKKAALIRKLYEDKLREALEEASE
NGSLFKSQDIDQDNGDGSLGRSRSLARLHAQREFLRATALAAERIIESEDSIPELREALT
KFLSMYPKYQASEKIDQLRSDEYSHLSSSASKVCLDYCGFGLFSYVQTLHYWDTCTFSLS
EITANLSNHALYGGAESGTVEHDIKTRIMDYLNIPENEYGLVFTVSRGSAFRLLAESYPF
QSNKRLLTMFDHESQSVNWMAQTAREKGAKAYNAWFKWPTLKLCSTDLKKRLSYKKRKKK
DSAVGLFVFPAQSRVTGTKYSYQWMALAQQNHWHVLLDAGSLGPKDMDSLGLSLFRPEFI
ITSFYRVFGHDPTGFGCLLIKKSVMGSLQSQSGKTGSGIVKITPEYPLYLSDSVDGLDGL
VGFEDHNDDKTKEAHRPGTQMPAFSGAYTSAQVRDVFETELLEDNISSDRDGTTSTTIFE
ETESVSVGELMKSPVFSEDESSDNSFWIDLGQSPLGSDQHNKIASPLPPIWLTNKRKQKQ
RQSPKPIPKSYSSPLYDGNDVLSFDAAVMSVTEHGTNSTPSRNRRSSSNHLHVQEIQEEN
CGHSFANGLKSSNISSEIKESAIRRETEGEFRLLGGRDGGRSRLLGVEDEHPSKGRRVSF
NMERVSHSIVEPGEASLASVYDEDYINTSDVENGDDEGADDEWDRRDTETEIVCRHIDHV
NMLGLNKTTTRLRFLINWLVISLLQLQVPESGGRHMNLVQIYGPKIKYERGAAVAFNVRD
KSKGFVSPEIVQRLGDREGVSLGIGILSHIRIVDEKPRNHRARTKEDSALHLQNEAGKNG
FIRFEVVTASLSFLTNFEDVYKLWVFVAKFLNPGFSREGSLPTVEEEEEEAENSET

www.000webhost.com

Other information
Ka divergence:-0.015438KaKs divergence:0.00815661
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):2688Length 2 (bp):2691Length divergence:0.001
MFE 1 (kcal):-814.46MFE 2 (kcal):-799.56MFE divergence-0.009