Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G23530-AT4G37110
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Zinc-finger domain of monoamine-oxidase A repressor R1
Function (paralog2):Zinc-finger domain of monoamine-oxidase A repressor R1

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.72119508290237
Log2 mRNA fold difference:0.75244909944253
Log2 TE fold difference:0.032749718085308
Sequences
Protein sequence

MLTMRTEAQDSVPKSNPNPELIKETPKVSLYEQCREERIKENLQRMNNLGLLNLSRKLKP
KTRPVKRSYGNRNSVQNPTPPLQPSRRSSRLENTTPVIYTDGINEKGKKASKRESVVIGE
GIRAEIYTEEHEKLLGNTERSWTCFVDGYDKNGKRIYDPFNGKTCHQCRQKTMGHRTQCS
ECNLVQGQFCGDCLFMRYGEHVLEALENPDWICPACRGICNCSLCRNNKGWVPTGPIYRR
IAALGYKSVAHYLIQTKRAPTDDTTPSQASAKRSLSFQEKIAGDEDVPMLENDDSLQKEE
GENTNEDQNGDLPEEVQKVQNMECQSGGSLKKEEDETPNSARRSLSFLLPSVEDDQTSLV
DVQVLSCLVPPKQEHSCAHNGDDLPDIQERIGQHSNLETKPDSYLLHVDEQIPLVDVQVL
SYLETPKQEHSCAHIGDGLPKIQEWIGQDPTSETKPVSYLIPIDDDQTSLVDAQVMYLET
PKQDKQEHSCAHIGDDLPEIQQGTGQDSNLETRLGESQTLVVKARVTRSKRKAALEPNPD
SIGGRLRQRRRT

MPVVRTRAKCSIPVTNPNPTVGGGNSNVSIYEKCREDRIKENLQRMKNLGIMDLSLKLKS
EIRPAKRRYGNSNANPGRETSPIQLSVSSRRSSRLKQEPPVSRRSSRLKNATPVSYAEEP
ELKKGKVSKEEIVLWVGEGVRPEIYTEEHEKLLGNTERTWELFVDGCDKNGKRIYDPVRG
KCCHQCRQKTLGYHTQCSQCNHSVRGQFCGDCLYMRYGEHVLEALENPDWICPVCRDICN
CSFCRTKKGWLPTGAAYRKIHKLGYKSVAHYLIQTNQQSETSEDDETDAPADSQASEGDH
LLLITDGIQDNQIDENLDDDDGSNKNPDSARKSLCFLSSGNNQTSVTDGDLKPLDVKEVD
PATPVIIDLEAQCSETERMANSANKENRETRSKRKMSAEPNPNSIGGRLRQRRKIQA

www.000webhost.com

Other information
Ka divergence:-0.0190394KaKs divergence:0.114264
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):1659Length 2 (bp):1254Length divergence:-0.139
MFE 1 (kcal):-480.44MFE 2 (kcal):-387.5MFE divergence-0.107