Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G23630-AT4G37160
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SKU5 similar 16
Function (paralog2):SKU5 similar 15

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.1925553099125
Log2 mRNA fold difference:1.434849222632
Log2 TE fold difference:-0.20234500022205
Sequences
Protein sequence

MKQKHLLLLGFLLAYCFSSVFVINAEDPYLFFTWTVTYGTRSPLGVPQQVILINGQFPGP
PIEGVTNNNIVVNVINKLDEPFLITWNGIKQRKMSWQDGVLGTNCPIQPKSSWTYHFQLK
DQIGTYAYFASTSMHRASGAFGALNVNQRSVIFVPYPKPDADFTLLVSDWYKMGHKELQR
RLDSSRALPPPDGLLINGASKGLVFTGQHGKIYRFRISNVGISTSINFRIQGHMMTLVEV
EGSHTLQEVYESLDIHVGQSVTVLVTLKAPVKDYFIVASTRFTKPILTTTGILSYQGSKI
RPSHPLPIGPTYHIHWSMKQARTIRLNLTANAARPNPQGSFHYGTIPINRTFVLANGRAM
INGKLRYTVNRVSYVNPATPLKLADWFNIPGVFNFKTIMNIPTPGPSILGTSVFDVALHE
YVEFVFQNNEGSIQSWHLDGTSAYVVGYGSGTWNMAKRRGYNLVDAVSRHTFQVYPMSWT
SILVSLDNKGMWNLRSQIWSRRYLGQELYVRVWNNEKSLYTESEPPVNVLFCGKAKHPRL
I

MKQTNLLVCKLFIGALFWLGSVLVNAEDPYMFYTWTVTYGTRSPLGVPQQVILINGQFPG
PAIEAVTNNNIVVNLINKLDEPFLITWNGVKQRRTSWQDGVLGTNCPIQPNSNWTYQFQL
KDQIGTYTYFASTSLHRASGAFGALNINQRSVITTPYPTPDGDFTLLVSDWFSNMTHKDL
RKSLDAGSALPLPDALLINGVSKGLIFTGQQGKTYKFRVSNVGIATSINFRIQNHTMSLI
EVEGAHTLQESYESLDVHVGQSMTVLVTLKASVRDYFIVASTRFTKPVLTTTASLRYQGS
KNAAYGPLPIGPTYHIHWSMKQARTIRMNLTANAARPNPQGSFHYGTIPINRTLVLANAA
TLIYGKLRYTVNRISYINPTTPLKLADWYNISGVFDFKTIISTPTTGPAHIGTSVIDVEL
HEFVEIVFQNDERSIQSWHMDGTSAYAVGYGSGTWNVTMRKRYNLVDAVPRHTFQVYPLS
WTTILVSLDNKGMWNLRSQIWSRRYLGQELYVRVWNDEKSLYTEAEPPLNVLYCGKAKRP
L

www.000webhost.com

Other information
Ka divergence:-0.205932KaKs divergence:0.433708
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):1626Length 2 (bp):1626Length divergence:0
MFE 1 (kcal):-478.9MFE 2 (kcal):-469.64MFE divergence-0.01