Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G23690-AT4G37240
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.23208843663087
Log2 mRNA fold difference:-0.10033976085309
Log2 TE fold difference:0.35322919468892
Sequences
Protein sequence

MGICSSYESTQVATAKLILHDGRMMEFTSPVKVGYVLQKNPMCFICNSDDMDFDNVVSAI
SADEEFQLGQLYFALPLSSLHHSLKAEEMAALAVKASSALMRSGGSCGRDKCRCRRKCVS
PVIFSARRVAAVGANGETRNGKRRGGGGSGRRKYAAKLSKIEE

MGICSSSESTQVATAKLILQDGRMMEFANPVKVGYVLLKYPMCFICNSDDMDFDDAVAAI
SADEELQLGQIYFALPLCWLRQPLKAEEMAALAVKASSALMRGGGGGCRRKCVEPIVSDK
LRMRVGSGDDTVGSGSGRRKVRNGDGGGSVSSSRRRKCYAAELSTIDE

www.000webhost.com

Other information
Ka divergence:0.260995KaKs divergence:0.72081
GC content 1 (%):48GC content 2 (%):51GC content divergence:0.03
Length 1 (bp):492Length 2 (bp):507Length divergence:0.015
MFE 1 (kcal):-156.9MFE 2 (kcal):-180.11MFE divergence0.069