Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G23910-AT4G30470
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):NAD(P)-binding Rossmann-fold superfamily protein
Function (paralog2):NAD(P)-binding Rossmann-fold superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:2.7066085822296
Log2 mRNA fold difference:2.2923208524119
Log2 TE fold difference:0.43658322313088
Sequences
Protein sequence

MNQEKTISCCCVLDASTYVGFWILKRLLTRGYSVHAAIRKNGESVLEEKIRDMEANEERL
EVYDVDVLDYQSILISLNNCNAVFCCLDNPEGYDEEKEVDLEVRGAINVVEACARTESIE
KIVFSSSLTAAIWRDNIGTQKDVDEKCWSDLDFCLKKKLWHALAKTQSEKAAWALAMDRM
VNMVSVNPGLIVGPSVAQHNPRPTMSYLKGAAQMYENGVLAYVDVEFVADVHIRAFEDTS
ACGRYFCFNQIVNTEEEALKLVQTLSPLIPMPPRHEKEMQGSEVYEERLRNKKLNKLVEA
GFAC

MDHDKSTSCCCVLDASTYVGFWILKKLLSRGYSVHAAIRRNGESEIEEMIREMETTEERL
VVYDVDVLDYQSILVSLKTCNVVFCCLDSPEGYDEKEVDLEVRGAINVVEACGRTESIEK
IVFSSSLTASIWRDNIGTQKDVDEKCWSDQDFCRSKKLWHALAKMLSEKAAWALAMDRRL
NMVSINPGLVVGPSVAQHNARPTMSYLKGAAQMYENGVLAYVDVKFLADVHIRAFEDVSA
CGRYFCFNQIVNTEEEALKLVESLSPLIPMPPRYENEMHGSEVYEERLRNNKLSKLVEAG
SAC

www.000webhost.com

Other information
Ka divergence:0.0554037KaKs divergence:0.0693878
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):915Length 2 (bp):912Length divergence:-0.002
MFE 1 (kcal):-273.21MFE 2 (kcal):-281.79MFE divergence0.015