Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G23940-AT4G30500
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF788)
Function (paralog2):Protein of unknown function (DUF788)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.4861580935696
Log2 mRNA fold difference:-1.1506169921614
Log2 TE fold difference:-1.233807807934
Sequences
Protein sequence

MANQGAKKRKEENAKHMAKLRRIIIASNAVYFVVRMLIFYSSFTWKHWIGLVITSLAYAF
PYKQLDQMAKPSVTDDGELIDGGFDMTTGGICGYLHDVIYITCFVQLASIITGKFWYTYL
VIPAFGVYKASGLIRGFMSQGSEGGVEDEKSRKKREKMERKASRGQVVKTRTR

MANQGAKKRKDENARHMAKLRLIMILCNILYVLVRVIISHSSHTWKNWIGLVLTSLGYGI
PYKLLHQMAKPSVSDAGELLDGGFDMSTPGMCGYLHDVLYITCFVQVGSIISGKFWYAYL
VIPAFGAYKASGLIKGLLSHGSEGGVEDEKTRKKREKMERKASRGQVVKTRSR

www.000webhost.com

Other information
Ka divergence:0.311338KaKs divergence:0.103157
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):522Length 2 (bp):522Length divergence:0
MFE 1 (kcal):-147.7MFE 2 (kcal):-142.7MFE divergence-0.017