Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G23950-AT4G30520
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Leucine-rich repeat protein kinase family protein
Function (paralog2):Leucine-rich repeat protein kinase family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.75842386807316
Log2 mRNA fold difference:-0.93677580134497
Log2 TE fold difference:0.32536970485452
Sequences
Protein sequence

MVVMKLITMKIFSVLLLLCFFVTCSLSSEPRNPEVEALINIKNELHDPHGVFKNWDEFSV
DPCSWTMISCSSDNLVIGLGAPSQSLSGTLSGSIGNLTNLRQVSLQNNNISGKIPPEICS
LPKLQTLDLSNNRFSGEIPGSVNQLSNLQYLRLNNNSLSGPFPASLSQIPHLSFLDLSYN
NLRGPVPKFPARTFNVAGNPLICKNSLPEICSGSISASPLSVSLRSSSGRRTNILAVALG
VSLGFAVSVILSLGFIWYRKKQRRLTMLRISDKQEEGLLGLGNLRSFTFRELHVATDGFS
SKSILGAGGFGNVYRGKFGDGTVVAVKRLKDVNGTSGNSQFRTELEMISLAVHRNLLRLI
GYCASSSERLLVYPYMSNGSVASRLKAKPALDWNTRKKIAIGAARGLFYLHEQCDPKIIH
RDVKAANILLDEYFEAVVGDFGLAKLLNHEDSHVTTAVRGTVGHIAPEYLSTGQSSEKTD
VFGFGILLLELITGMRALEFGKSVSQKGAMLEWVRKLHKEMKVEELVDRELGTTYDRIEV
GEMLQVALLCTQFLPAHRPKMSEVVQMLEGDGLAERWAASHDHSHFYHANMSYRTITSTD
GNNQTKHLFGSSGFEDEDDNQALDSFAMELSGPR

MVVVTKKTMKIQIHLLYSFLFLCFSTLTLSSEPRNPEVEALISIRNNLHDPHGALNNWDE
FSVDPCSWAMITCSPDNLVIGLGAPSQSLSGGLSESIGNLTNLRQVSLQNNNISGKIPPE
LGFLPKLQTLDLSNNRFSGDIPVSIDQLSSLQYLRLNNNSLSGPFPASLSQIPHLSFLDL
SYNNLSGPVPKFPARTFNVAGNPLICRSNPPEICSGSINASPLSVSLSSSSGRRSNRLAI
ALSVSLGSVVILVLALGSFCWYRKKQRRLLILNLNDKQEEGLQGLGNLRSFTFRELHVYT
DGFSSKNILGAGGFGNVYRGKLGDGTMVAVKRLKDINGTSGDSQFRMELEMISLAVHKNL
LRLIGYCATSGERLLVYPYMPNGSVASKLKSKPALDWNMRKRIAIGAARGLLYLHEQCDP
KIIHRDVKAANILLDECFEAVVGDFGLAKLLNHADSHVTTAVRGTVGHIAPEYLSTGQSS
EKTDVFGFGILLLELITGLRALEFGKTVSQKGAMLEWVRKLHEEMKVEELLDRELGTNYD
KIEVGEMLQVALLCTQYLPAHRPKMSEVVLMLEGDGLAERWAASHNHSHFYHANISFKTI
SSLSTTSVSRLDAHCNDPTYQMFGSSAFDDDDDHQPLDSFAMELSGPR

Other information
Ka divergence:-0.0322108KaKs divergence:0.225583
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1905Length 2 (bp):1947Length divergence:0.011
MFE 1 (kcal):-577.76MFE 2 (kcal):-584.88MFE divergence0.006