Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G23980-AT4G30560
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cyclic nucleotide-gated channel 6
Function (paralog2):cyclic nucleotide gated channel 9

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.60251881131863
Log2 mRNA fold difference:0.46581459464627
Log2 TE fold difference:0.12440618259182
Sequences
Protein sequence

MFDTCGPKGVKSQVISGQRENFVRLDSMDSRYSQSSETGLNKCTLNIQGGPKRFAQGSKA
SSGSFKKGFRKGSEGLWSIGRSIGLGVSRAVFPEDLEVSEKKIFDPQDKFLLLCNKLFVA
SCILAVSVDPLFLYLPFINDKAKCVGIDRKLAIIVTTIRTVIDSFYLFHMALRFRTAYVA
PSSRVFGRGELVIDPAQIAKRYLQQYFIIDLLSVLPVPQIIVWRFLYTSRGANVLATKQA
LRYIVLVQYIPRFLRMYPLSSELKRTAGVFAETAWAGAAYYLLLYMLASHIVGALWYLLA
LERNNDCWSKACHNNQNCTRNFLFCGNQNMKGYAAWDNIKVSYLQLKCPVNVPEDEEPPF
DFGIYLRALSSGIVSSKNFVSKYFFCLWWGLQNLSTLGQGLETSTYPGEVIFSITLAIAG
LLLFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHHRMLPPELRERVRRYDQYKWLET
RGVDEENLVQNLPKDLRRDIKRHLCLALVRRVPLFENMDERLLDAICERLKPCLFTEKSY
LVREGDPVNEMLFIIRGRLESVTTDGGRSGFYNRSLLKEGDFCGDELLTWALDPKSGSNL
PSSTRTVKALTEVEAFALIADELKFVASQFRRLHSRQVQHTFRFYSQQWRTWAACFMQAA
WRRYIKRKKLEQLRKEEEEEEAAAASVIAGGSPYSIRATFLASKFAANALRSVHKNRTAK
STLLLSSTKELVKFQKPPEPDFSAEDH

MLDCGKKAVKSQVISGRLEKFVRLDSMDSRYSQTSDTGLNRCTLNLQGPTRGGGAQGNNV
SSGSFKKGFRKGSKGLWSIGRSIGLGVSRAVFPEDLKVSEKKIFDPQDKFLLLCNKLFVT
SCILAVSVDPLFLYLPFVKDNEKCIGIDRKLAIIATTLRTVIDAFYLFHMALRFRTAFVA
PSSRVFGRGELVIDPAQIAKRYLQQYFIIDFLSVLPLPQIVVWRFLYISKGASVLATKRA
LRSIILVQYIPRFIRLYPLSSELKRTAGVFAETAWAGAAYYLLLYMLASHIVGAIWYLLA
LERYNGCWTKVCSNSSLDCHRNFLFCGNEKMDGYAAWTTIKDSVLQLNCPVNTTDNPPFD
FGIYLRALSSGIVSSKSFVSKYFFCLWWGLQNLSTLGQGLETSTYPGEVIFSIALAIAGL
LLFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHHRMLPPELRERVRRYDQYKWLETR
GVDEENLVQNLPKDLRRDIKRHLCLALVRRVPLFENMDERLLDAICERLKPCLYTESSYL
VREGDPVNEMLFIIRGRLESVTTDGGRSGFFNRSLLKEGDFCGEELLTWALDPKSGSNLP
SSTRTAKALTEVEAFALIADELKFVASQFRRLHSRQVQHTFRFYSQQWRTWAAIFIQAAW
RRYVKKKKLEQLRKEEEEGEGSVTSIRATFLASKFAANALRKVHKNRIEAKSTIELVKYQ
KPSEPDFSADDTS

www.000webhost.com

Other information
Ka divergence:0.394491KaKs divergence:0.550857
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):2244Length 2 (bp):2202Length divergence:-0.009
MFE 1 (kcal):-686.67MFE 2 (kcal):-676.91MFE divergence-0.007