Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G24050-AT4G30680
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):MIF4G domain-containing protein / MA3 domain-containing protein
Function (paralog2):Initiation factor eIF-4 gamma, MA3

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.7053377973815
Log2 mRNA fold difference:1.3787365583018
Log2 TE fold difference:-4.0356709018006
Sequences
Protein sequence

MQQQGEPSVLSLRPGGGGGKSRLFVPRFSSSSSFDLTNGGSEETPFPVKRENSGERVRFS
REEILQHRESVQVSDEILRRCKEIAVELFGEEQSWGNHAAESKITNHTQHRHTETDNRDW
HSRSQIPTSGKEWLRDDPREAKSTWQGSGPTPVLIKAEVPWSAKRGALSDKDRVVKSVKG
ILNKLTPEKYELLKGQLIDAGITSADILKEVIQLIFENAILQPTFCEMYALLCFDINGQL
PSFPSEEPGGKEITFKRVLLNNCQEAFEGAGKLKEEIRQMTNPDQEMERMDKEKMAKLRT
LGNIRLIGELLKQKMVPEKIVHHIVQELLGDDTKACPAEGDVEALCQFFITIGKQLDDSP
RSRGINDTYFGRLKELARHPQLELRLRFMVQNVVDLRANKWVPRREEVKAKKINEIHSEA
ERNLGMRPGAMASMRNNNNNRAAVSGAADGMGLGNILGRPGTGGMMPGMPGTRVMPMDED
GWEMARTRSMPRGNRQTVQQPRFQPPPAINKSLSVNSRLLPQGSGGLLNGGGRPSPLLQG
NGSSSAPQASKPIPTVEKPQPRSQPQPQPQAAPLANSLNAGELERKTKSLLEEYFSIRLV
DEALQCVEELKSPSYHPELVKETISLGLEKNPPLVEPIAKLLKHLISKNVLTSKDLGAGC
LLYGSMLDDIGIDLPKAPNSFGEFLGELVSAKVLDFELVRDVLKKMEDEWFRKTVLNAVI
KSVRECPSGQSVLDSQAVEVEACQSLL

MQQGDSMLSLRPGGGRGGSRRFAPRFTLSSSSDLTNGGDAPSFAVKGSGGLLNDRPSALV
QGNGSQQPKPVPSPTRQTVEKPKPQPQPQEVAPPTTTSLNTVELSRKTNSLLEEYFNVRL
LDEALQCIEELKTPSYHPELVKEAISLGLEKNPPCVEPVAKLLEHLVSKNVLTPKDLRNG
CLLYGSMLDDIGIDLPKAPNNFGEILGSLVMAKASDSELVKEILMKMGDEWFKKAVLEAV
MRSVSESLLTTEAVEVEACRGLV

www.000webhost.com

Other information
Ka divergence:0.160456KaKs divergence:-0.0988266
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):2244Length 2 (bp):792Length divergence:-0.478
MFE 1 (kcal):-748.91MFE 2 (kcal):-259.3MFE divergence-0.486