Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G24060-AT4G30690
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Translation initiation factor 3 protein
Function (paralog2):Translation initiation factor 3 protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.92224661791977
Log2 mRNA fold difference:-0.1513133752582
Log2 TE fold difference:-0.78924870267043
Sequences
Protein sequence

MAGITSSTVGFNAVFTGITKTVSSHSLFSVDSKLCSLRLSKTELSFTNLTPSPRRAFAVT
CRFGGGGGGYRFSGDNRRGRPKEAEIDEALDISSIRSATVRLIDGQQNMLGLVSKDEAVR
MADDAELDLVILSPDADPPVVKMMDYSKYRYEQQKRKKDQQKKTTRMDLKELKMGYNIDQ
HDYSVRLRAAQKFLQDGDKVKVIVSMKGRENEFRNIAIELLRRFQTEIGELATEESKNFR
DRNMFIILVPNKEMIRKPQEPPTRKKKKTAENEASASAAEITAEPEPEPEPEPEPEPEPE
PEPEPEPLQIDS

MAGITSTVGFNAILAGATKTVSHPVKSKLFGLRLCVPEFSIVSLSPYHHRRCPAITCRYG
GGGGGGSRFPGDRRGRQKESEDDDSLDISAIRSATVRLIDDQQNMIGLVSKEEAVRRAED
AELDLVILSPDADPPVVRMMDYSKYRYEQQKRKKEQQKKTTRMDLKELKMGYNIDQHDYS
VRMRAARKFLQDGDKVKVIVNMKGRENEFRNIAIELLRRFQTEIGELGTEESKNFRDRNL
FIVLVPNKEVIRKVQEPPPKKKKKPADDKVSAANITATQDI

www.000webhost.com

Other information
Ka divergence:-0.0893246KaKs divergence:0.0651527
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):939Length 2 (bp):846Length divergence:-0.052
MFE 1 (kcal):-257.86MFE 2 (kcal):-246.61MFE divergence-0.022