Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G24070-AT4G30740
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Family of unknown function (DUF566)
Function (paralog2):

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:2.8348683354425
Log2 mRNA fold difference:1.1412590931528
Log2 TE fold difference:1.6358099319583
Sequences
Protein sequence

MQVGSKKASMGKQQQSVSDATSPRPPLAPSEKNNVGSVTRRARTMEVSSRYRSPTPTKTR
RCPSPIVTRTAPSSSPESFLKRAVSAERNRGPSTPTTPVSDVLVDLPVSSRRLSTGRLPE
SLWPSTMRSLSVSFQSDSVSVPVSKKEKPLVTSSTDRTLRPSSSNIAHKQQSETTSVTRK
QTPERKRSPLKGKNVSPGQSENSKPMDGSHSMLIPPQHRWSGRIRGNRSFDLGDKAVRRV
SLPLSNKSSRHKKSSSDITRLFSCYDNGRLEVSSSTTSEDSSSTESLKHFSTSSLPRLHP
MSAPGSRTASPSRSSFSSSSSSNSRGMSPSRGVSPMRGLSPVGNRSLVRSSTPPSRGVSP
SRIRQTAQSSSTNTSVLSFIADVKKGKKATYIEDVHQLRLLYNRYSQWRFANARAEGVSY
VQSLIAKETLYNVWHAISDLRDLVTTQRICLQQLKLEIKLRSILNDQMVCLEDWAMVERE
HISSLAGAIGDLEANTLRLPLAGGTKADLGSLKLAMSSALDVMQSMGSSIWSLHSQMEEM
NKLVSDLAVIAKTENFLLDKCENLLASTAVMEIEERSLKTHLIQKKQEEEVRDDAESSPL
LPLSKFQWP

MRILSVSFQSDSVSVPVSKKERLVSSSSGDRTLRPSSNIAQKHKAETTSVSRKPTPERKR
SPLKGKNNVSDLSENSKPVDGPHSRLIEQHR

www.000webhost.com

Other information
Ka divergence:0.0458674KaKs divergence:-0.999746
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1830Length 2 (bp):276Length divergence:-0.738
MFE 1 (kcal):-566MFE 2 (kcal):-70.9MFE divergence-0.777