Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G24100-AT4G30780
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.43778769608081
Log2 mRNA fold difference:-0.46702878748144
Log2 TE fold difference:0.87820515508912
Sequences
Protein sequence

MVEMMRSENHLRQASKHRNNNFPVKLEIIEDSLEEEHAPLNKRSKLWSNGTSVSKFSLLE
EPSPLGLSLKKSPSFQELIEMKLSQSGDDSNSVKKESFGFGGVGTVEKLKASNFPATILR
IGQWEYKSRYEGDLVAKCYFAKHKLVWEVLEQGLKSKIEIQWSDIMALKANLPEDEPGTL
TIVLARRPLFFRETNPQPRKHTLWQATSDFTDGQASMNRQHFLQCPPGIMNKHFEKLVQC
DHRLFCLSRQPEINLAAPFFDSRLSIFEDPSVSGSHNIASPVGAQSSSEHVSLSHDALSP
SSVMDARAIEGVGGSIDSRNTNGWSQIKMPGLHQSISMNDFLTFLSDQACENNQEFEEMK
QLLLSDNTQTDPSDEKSVMSKVNSFCNLLQSAANSQLNIETADTERVVGVDNNRHMPEGG
KRVVDPASSSKPLQGMSRKDSFSDLLVHLPRITSLPKFLFNISEED

MVEMRKSGGLRPESESAARCRDELPVKLEIAEDDLEEEHGPLNKRSRLWSPGTSSSTMAP
AKYNPLDEPSPLGLSLKKSPSLLELIQMKITHCGDPKAAETLKAGALGSGLKRESKTIAA
AASVGPTLAPGSIEKLKASNFPASLLKIGQWEYKSRYEGDLVAKCYFAKHKLVWEVLEQG
LKSKIEIQWSDIMALKANCPEDGPGTLTLVLARQPLFFRETNPQPRKHTLWQATSDFTDG
QASMNRQHFLQCAQGIMNKHFEKLVQCDHRLFHLSRQPEIAIDSPYFDARQSIFEDPSES
KGHPFGNLNLSTGPSISGTQNLASPVGAQSSSEHMYLSHEAPSPSSVIDARANEGIGGSE
AVNSRNRTDCGQIEAPGIHQSMSLSDFLAVLCDTKNTTDLNLADDVDGLHQSMSVSDFVA
YLSDSRNITDSDQIKVPGLHQSMSVSDFVGLLSDSAGGSHPEHMEKFEIMKQQLLSDNIQ
FEAPDEKSLMPRVNSLFNLLYKDPNVAANSQLNTEMSVGLKSEPKGIVSDNNNNNNNNNR
VLDTASSSKPQGMLRKDSFSDLLLHLPRITSLPKFLSNISEEDGDAYNR

www.000webhost.com

Other information
Ka divergence:-0.240944KaKs divergence:0.0274297
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1401Length 2 (bp):1770Length divergence:0.116
MFE 1 (kcal):-422.69MFE 2 (kcal):-539.41MFE divergence0.121