Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G24150-AT4G30850
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):heptahelical protein 3
Function (paralog2):heptahelical transmembrane protein2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.1980412511381
Log2 mRNA fold difference:-1.8890757731336
Log2 TE fold difference:0.65406443535197
Sequences
Protein sequence

MKRRRSAKKSPAMVTVTDWKGLDCGEETRIVRRLMKFEDLPEYLKDNEFIHNHYRCQWSL
KDTFLSAFSWHNETLNIWTHLIGFGIFLWMTVVSCLETTEISLAGVFNGMAGVRICLSSN
QTLLHDSNVTHHISCLTSQGEAIPKWPWLVYLVGAMGCLICSSVSHLLACHSKRFNVFFW
RLDYAGISLMIVASFFAPIYYAFSCHPNFRLLYLSSISILGLLAIITLLSPALSTPRFRP
FRANLFLAMGSSAVIPATHVLCLYWDHPNVFIALGYEIATALSYFVGATFYVSRVPERWK
PGAFDMAGHSHQIFHVFVVMGALAHCVTTLLIIDFSRASPSCGF

MQKRRTVKESTKIRNGKGMDSGEKKRSEKRLMKFEELPRYLKDNEFIHNHYRCEWSIKET
FLSAFSWHNETLNIWTHLCGFAIFTWMMVVSSMETTELGLAGFVSLLSGATIRWPWPSMA
MSKDVYFSSDQTLHHDLNVTHTRSLLNSQGDVNYEAIPKWPWLVFLTGAMGCLICSSMSH
LFACHSRRFNLFFWRLDYAGISLMIVCSFFAPIYYAFSCHTYWRLFYLSSISILGLLAIF
TLLSPSLSAPRFRSFRAALFLTMGFSGVIPATHVLYLHKDHPNVLIALVYELAMAVLYAT
GAAFYVTRIPERWKPGAFDIAGHSHQIFHVFVVLGALAHSVASLLIMDFRRASPSCAF

www.000webhost.com

Other information
Ka divergence:-0.268765KaKs divergence:0.146121
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1035Length 2 (bp):1077Length divergence:0.02
MFE 1 (kcal):-306.11MFE 2 (kcal):-336.59MFE divergence0.047