Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G24200-AT4G30920
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Cytosol aminopeptidase family protein
Function (paralog2):Cytosol aminopeptidase family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.0042403565921
Log2 mRNA fold difference:-0.94831803506471
Log2 TE fold difference:0.16963219220072
Sequences
Protein sequence

MAHTLGLTQPNSTEPHKISFTAKEIDVIEWKGDILVVGVTEKDLAKDGNSKFENPILSKV
DAHLSGLLAQVSSEEDFTGKPGQSTVLRLPGLGSKRIALIGLGQSVSSPVAFHSLGEAVA
TVSKASQSTSAAIVLASSVSDESKLSSVSALASGIVLGLFEDGRYKSESKKPSLKAVDII
GFGTGAEVEKKLKYAEDVSYGVIFGRELINSPANVLTPAVLAEEAAKVASTYSDVFTANI
LNEEQCKELKMGSYLAVAAASANPPHFIHLVYKPPNGSVKTKLALVGKGLTFDSGGYNIK
TGPGCSIELMKFDMGGSAAVLGAAKAIGEIKPPGVEVHFIVAACENMISGTGMRPGDVIT
ASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACVIALGTSMAGIYTPS
DELAKEVIAASERSGEKLWRMPLEESYWEMMKSGVADMVNTGGRAGGSITAALFLKQFVS
EKVQWMHIDMAGPVWNEKKKSGTGFGVATLVEWVQKNSSS

MAVTLVTSFASSSSRFHFRSFSSSPSSLSSCFVRFQFPSRLRLAFAVTPLYSSSRAMAHT
ISHATLGLTQANSVDHPKISFSGKEIDVTEWKGDILAVGVTEKDMAKDVNSKFENPILKK
LDAHLGGLLADVSSEEDFSGKPGQSTVLRLPGLGSKRVGLIGLGKSASTPSAFQSLGEAV
AAAAKASQASSVAVVLASSESVSNESKLCSASAIASGTVLGLFEDSRYKSESKKPSLKSV
DIIGFGSGPELEKKLKYAEHVSYGVIFGKELVNSPANVLTPAVLAEEALNLASMYSDVMT
ANILNEEQCKELKMGSYLAVAAASANPPHFIHLIYKPSSGPVKTKLALVGKGLTFDSGGY
NIKTGPGCLIELMKFDMGGSAAVLGAAKAIGQIKPPGVEVHFIVAACENMISGTGMRPGD
VLTASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKVVDLATLTGACIIALGTSMAGIY
TPSDKLAKEVIAASERSGEKLWRMPMEESYWEMMKSGVADMVNTGGRAGGSITAALFLKQ
FVSEDVEWMHIDMAGPVWNEKKKAATGFGVATLVEWVQNHSSS

Other information
Ka divergence:-0.112652KaKs divergence:-0.307993
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1563Length 2 (bp):1752Length divergence:0.057
MFE 1 (kcal):-517.06MFE 2 (kcal):-602.71MFE divergence0.076