Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G24240-AT4G30940
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):BTB/POZ domain with WD40/YVTN repeat-like protein
Function (paralog2):BTB/POZ domain with WD40/YVTN repeat-like protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.7696801593817
Log2 mRNA fold difference:-1.2188664110935
Log2 TE fold difference:-0.52688044896727
Sequences
Protein sequence

MGISKDRIKFNVGGRLFETTATTLANAGRDSFFGALFDDEWNLSPLEDSILFVDRNSDCF
AVLLDLLRTGDLNVPANIPERLLHREASFYGLLDHVRTAKWGPFDGNRLRLSDSVKGIAP
GDGTAIRAGPDGGCCVAHGSVVHVFDWMLEEHSPINLDYQRVNDVGWIDSDNIVLSACEK
LGRGDGGMGLFSSSSGDLRYKFQVCHENQVKSYTAGALSFSPDYEIFASCKGRSNEYGIG
VWDQITGKQTDFFYESPGWSLGDADKLQWLNGKNCLLVATLFPRKDNCYISLLDFRDKNM
VWSWSDIGSPMAIDEKRVRDAIAMEDSNSICVVNEFEDLGFIDLRMYGGSVRWSSRSKLM
KSKMPDEPCYPKLALHEGQLFSSMNDSISVFCGPDWVLTSRLRRSYGGSICDFSIGGDRL
FALHSEENVFDVWETPPCPII

MGLSNDRIKFNVGGRIFETTATTLANAGRDSFFGALFDENWNLSQPGDLFIDRNPDCFAV
LLDLLRTGDLNIPPNIPERLLHKEAMFYGLIDHLRTAKWGPFDGNRLHLSRSVTGIAPGD
GTAIRAGPDGGCCIAHGSVVHVFDWMLEEHPTINLDYQRVNDVGWIDSGNIVLSACERLG
RGDGGMGLFSSSSGELRYKFQVSHDNQVKSYSAGALSFSPDSKIFTSCKGRSNEYGIGVW
DQSTGKQVDFFYESPGWSLGDADKLQWLSGKNCLLVATLFPRKDNCYISLLDFREKNMVW
SWSDIGFLTMAEEKRVRDAIAMEESNSICVVNEFEDLGFIDLRMDGGGSSVRWSSRSRLM
KSKMPDEPCYPKLALHEGQLFSSMNDSISVFCGSDWVLTSRLKRSYGGSICDFSIGGDRL
FALHSEENVFDVWETLPPPII

www.000webhost.com

Other information
Ka divergence:0.0651148KaKs divergence:-0.178257
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1326Length 2 (bp):1326Length divergence:0
MFE 1 (kcal):-464.2MFE 2 (kcal):-435.22MFE divergence-0.032