Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G24260-AT4G30980
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):LJRHL1-like 1
Function (paralog2):LJRHL1-like 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.15978522262388
Log2 mRNA fold difference:-1.9210170253774
Log2 TE fold difference:1.7304006208531
Sequences
Protein sequence

MMNSSLLTPSSSSSSHIQTPSTTFDHEDFLDQIFSSAPWPSVVDDAHPLPSDGFHGHDVD
SRNQPIMMMPLNDGSSVHALYNGFSVAGSLPNFQIPQGSGGGLMNQQGQTQTQTQPQASA
STATGGTVAAPPQSRTKIRARRGQATDPHSIAERLRRERIAERMKALQELVPNGNKTDKA
SMLDEIIDYVKFLQLQVKVLSMSRLGGAASVSSQISEAGGSHGNASSAMVGGSQTAGNSN
DSVTMTEHQVAKLMEEDMGSAMQYLQGKGLCLMPISLATAISTATCHSRNPLIPGAVADV
GGPSPPNLSGMTIQSTSTKMGSGNGKLNGNGVTERSSSIAVKEAVSVSKA

MNSSSLLTPSSSPSPHLQSPATFDHDDFLHHIFSSTPWPSSVLDDTPPPTSDCAPVTGFH
HHDADSRNQITMIPLSHNHPNDALFNGFSTGSLPFHLPQGSGGQTQTQSQATASATTGGA
TAQPQTKPKVRARRGQATDPHSIAERLRRERIAERMKSLQELVPNGNKTDKASMLDEIID
YVKFLQLQVKVLSMSRLGGAASASSQISEDAGGSHENTSSSGEAKMTEHQVAKLMEEDMG
SAMQYLQGKGLCLMPISLATTISTATCPSRSPFVKDTGVPLSPNLSTTIVANGNGSSLVT
VKDAPSVSKP

Other information
Ka divergence:0.145566KaKs divergence:-0.495972
GC content 1 (%):51GC content 2 (%):51GC content divergence:0
Length 1 (bp):1053Length 2 (bp):933Length divergence:-0.06
MFE 1 (kcal):-317.96MFE 2 (kcal):-257.01MFE divergence-0.106