Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G24300-AT4G31000
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Calmodulin-binding protein
Function (paralog2):Calmodulin-binding protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.9907035739278
Log2 mRNA fold difference:0.15597493238022
Log2 TE fold difference:-2.3530400093709
Sequences
Protein sequence

MNKRGYECSQEDTDKLPESKRQKVPALASVIVEAVKVDSLQRLCSSLEPLFRRIVSEEVE
RALSRLGNAKLTSRSPEPKRIQDRNGRNLQLHFRTRMPPHLFTGGKVEGERGSAIHVVLI
DANTGNVVQTGEESASKLNVVVLEGDFNDEDDEDWTREHFESFEVKEREGKRPILTGDTQ
IVLKEGVGTLGELTFTDNSSWIRSRKFRLGVKPASGYGDSFCIREAKTEPFAVKDHRGEL
YKKHYPPAVHDEVWRLDRIAKDGVLHKKLLKANIVTVEDFLRLLVKDPQKLRNLLGSGMS
NRMWENTVEHAKTCVLGGKLYVFYTDQTHATGVVFNHIYEFRGLITNGQFLSLESLNHDQ
KISADILVKLAYENWHKAIEYDGKLLNCLPVAEKEIKSLLEPKMVSAQTAPNHQQLHNQN
NRQTVQGHQNAITYSPVPQPIDYPQFAQQHCNQLLPSFPCNVQDYNRSMESSNDSSSYNG
EDWCPPRAAGQGLEDIFSEEIRLRSSEMLETDDMQRLLKTFGIGVNTVGTQGGFGQTDES
CYGYSIPYQAQIDNTYRRERNRGSGKAVVGWLKLKAALRWGIFIRKKAAERRPQIVEID

MENSMNNRGHGHNQEHADNLPESKRQKLPALASVIVEAVKVDSLQRLCSSLEPLFRRIVS
EEVERAISRLENSKSTSRSTEPNKIQGLDGRNLQLRFRTRMPPHLFTGGKVEGEQGSAIH
VVLIDANTGNVIQTGEESMTKLNIVVLDGDFNDEDDKDWTREHFESFEVKEREGKRPILT
GDRHVIIKEGVGTLGKLTFTDNSSWIRSRKFRLGVKPATGFHIREAKTEPFAVKDHRGEL
YKKHYPPVLHDEVWRLDKIAKDGALHKKLLKSNIVTVEDFLQILMKDPQKLRSLLGSGMS
NRMWDNTVEHAKTCVLGGKLYAYYTDQTHQTAVVFNHIYEFQGLIANGHFLSSESLNHDQ
KISADTLVKTAYENWHKVVEYGGKLLNCLPVAKKGIKSLPEPKMAQNHQTQQKALQCQQT
VNGYSSDPQHLIEYPFVQQPCYQLRDYTSMESSSVSGSYNGGLEDIFTEEIRARSSEMLE
TDNMQRLLKTFGISGGFGNRDESIYGFSDQYEAQIDKGYMREGGRGAGKAVVGWLKLKAA
LRWGIFIRKKAAERRPQIVEID

www.000webhost.com

Other information
Ka divergence:0.512187KaKs divergence:0.664152
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):1800Length 2 (bp):1689Length divergence:-0.032
MFE 1 (kcal):-526.48MFE 2 (kcal):-487.81MFE divergence-0.038