Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G24360-AT4G31170
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.67272173658252
Log2 mRNA fold difference:-0.39444511871879
Log2 TE fold difference:-0.28230512573445
Sequences
Protein sequence

MLEGAKFNVLAVGNHHNNDNNYYAFTQEFYQKLNEGSNMSMESMQTSNAGGSVSMSVDNS
SVGSSDALIGHPGLKPVRHYSLSVGQSVFRPGRVTHALNDDALAQALMDTRYPTEGLTNY
DEWTIDLRKLNMGPAFAQGAFGKLYKGTYNGEDVAIKILERPENSPEKAQFMEQQFQQEV
SMLANLKHPNIVRFIGACRKPMVWCIVTEYAKGGSVRQFLTRRQNRAVPLKLAVKQALDV
ARGMAYVHGRNFIHRDLKSDNLLISADKSIKIADFGVARIEVQTEGMTPETGTYRWMAPE
MIQHRAYNQKVDVYSFGIVLWELITGLLPFQNMTAVQAAFAVVNRGVRPTVPNDCLPVLS
DIMTRCWDANPEVRPCFVEVVKLLEAAETEIMTTARKARFRCCLSQPMTID

MLENPKFDLHAVGNHNNDNNYYAFTQDFYQKLGEEGTNMSVDSMQTSNAGGSVSMSVDNS
SVGSSDALIGHPGLKPMRHPYSLSDGQSVFRPGKVTHALNDDALAQALMDSKYPTEGLVN
YEEWTIDLRKLHMGPAFAQGAFGKLYRGTYNGEDVAIKLLERSDSNPEKAQALEQQFQQE
VSMLAFLKHPNIVRFIGACIKPMVWCIVTEYAKGGSVRQFLTKRQNRAVPLKLAVMQALD
VARGMAYVHERNFIHRDLKSDNLLISADRSIKIADFGVARIEVQTEGMTPETGTYRWMAP
EMIQHRPYTQKVDVYSFGIVLWELITGLLPFQNMTAVQAAFAVVNRGVRPTVPADCLPVL
GEIMTRCWDADPEVRPCFAEIVNLLEAAETEIMTNVRKARFRCCMTQPMTVD

www.000webhost.com

Other information
Ka divergence:0.273371KaKs divergence:0.292546
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):1236Length 2 (bp):1239Length divergence:0.001
MFE 1 (kcal):-390.5MFE 2 (kcal):-414.15MFE divergence0.029