Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G24390-AT4G31310
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):AIG2-like (avirulence induced gene) family protein
Function (paralog2):AIG2-like (avirulence induced gene) family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.74146394226907
Log2 mRNA fold difference:0.80506027189625
Log2 TE fold difference:-1.6736436404667
Sequences
Protein sequence

MSGTVTMHSVFVYGSLMADDVVRLLLNRIPQTASATLPDFHRFSIKGRVYPAIIPAKSDK
VSGKVLFGITDDELNVLDEFEDVEYERENVQVLLTDSSDEKLQTKTYVWAKKDDPDLYGT
WDFEEWKQLHMEGFLKMTKEFAEELNLPKSEI

MLSGKAAYDLFVYGSLQEPEVVYVLLNRVPDHVSAVLSGFHRFRLKGRVYPTILPDGTGK
VNGKVLKGITDDELKMLDEFEDVEYDRKTVEVMLTDTSEKLQVETYVWKNKDDPDLYGEW
DFEEWRQHDKEDFVTATKKFLENRRLPEAKTRMDTFKTFFKQDLENGKPLDS

Other information
Ka divergence:0.164129KaKs divergence:0.269317
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):459Length 2 (bp):519Length divergence:0.061
MFE 1 (kcal):-116.8MFE 2 (kcal):-153.15MFE divergence0.135