Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G24400-AT4G31320
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SAUR-like auxin-responsive protein family
Function (paralog2):SAUR-like auxin-responsive protein family

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:3.7235911285644
Log2 mRNA fold difference:4.550368794016
Log2 TE fold difference:-0.88017171756763
Sequences
Protein sequence

MEAKKSNKIREIVKLQQLLKKWRKQAIASKAANNNNEDNNSSGGGSKSIKFLKRTLSFTD
VTAVPKGYLAVSVGLEKKRYTIPTEYLSHQAFYVLLREAEEEFGFQQAGVLRIPCEVSVF
ESILKIMEEKNEGYLVTPITAKQECKFNAAADDKTSYQHPSDCPKTPSHQPHNSPMCR

MEAKKSNKIREIVKLQQILKKWRKVAHASKQANNNKIDNVDDSNNNISININNNGSGSGS
GSKSIKFLKRTLSFTDTTAIPKGYLAVSVGKEEKRYKIPTEYLSHQAFHVLLREAEEEFG
FEQAGILRIPCEVAVFESILKIMEDNKSDAYLTTQECRFNATSEEVMSYRHPSDCPRTPS
HQPHSPMCR

www.000webhost.com

Other information
Ka divergence:-0.206273KaKs divergence:-0.465671
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):537Length 2 (bp):570Length divergence:0.03
MFE 1 (kcal):-148.64MFE 2 (kcal):-145.99MFE divergence-0.009