Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G24420-AT4G31340
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DNA repair ATPase-related
Function (paralog2):myosin heavy chain-related

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.7726973622189
Log2 mRNA fold difference:2.032728339797
Log2 TE fold difference:-0.26004410473307
Sequences
Protein sequence

MAAAKLVALLLLLALVFNFTTCIFADAGIDGGDEPKLRSDGGDIELDQLNAKIRALESQI
DDKTKELKGREELVTEKEKLLQERQDKVASLETEVSSLRKKGSSDSVELLSKAQARATEL
EKQVEVLKKFLEQKNKEKELIEAQTSETEKKLNELNSRVEKLHKTNEEQKNKIRKLERAL
KISEEEMLRTKHEATTKAKELMEVHGAWLPPWFAVHWSSFQTVAGTHWDAHGKPVMEKVT
QKVTLAKNQAEKWAKPHMANVKTKYIPAIKETVKTHVEPHVQTLSTKAKEAYHASKSAVT
PHIVKFQEHVDPYYQEAKKFSKPYVDQVATATKPHVDKVRATMKPYTTKTVHYYKEFLES
ASTYHHQLQANVESKLKSHELLEPFATKEFIWFAASALLALPIFIVYKFLCSLFCTKTKK
PIRQSHQHTRRKARRGHSDK

MAAAKLVALLLLALLFTTSVFADADEPEVSEAAGSDGSSKIHLDQLNAKIRALESQIDEK
TREVQGKDEVVAEKEKLLKEREDKIASLQTEVSSLQKKGSSDSAKQLGKAQARADELEKQ
VEVLKNFLEQKNKEKDSTEARTNEAEKKLRELNSSLDKLQKTNEEQKNKIGKLERAIKIA
EEEMLRTKLEATTKAKELLEAHGSWLPPWLAVHWFKFQTYTETHWEAHGKPAVETVILKV
TEAKAQAEKWAEPHVENVKTKYIPAIKETVTIHVEPHFRTLSIKAKEAYHSSKSAVSPHI
VTVQEFVDPYYQEAKKFSKPYVDQVATTTKPHVDKMKVAMKPYTTKVIIVYTEFLESATT
YHNQVQAHVERKLKSHELTEPFATNEFVWFAASALLVFPIFVAYRVLSSLFCTKTKKPVK
HPHHHGRRKAKRAHTDK

www.000webhost.com

Other information
Ka divergence:-0.0830215KaKs divergence:0.00853081
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):1323Length 2 (bp):1314Length divergence:-0.003
MFE 1 (kcal):-371.52MFE 2 (kcal):-394.8MFE divergence0.03