Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G24440-AT4G31360
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):selenium binding
Function (paralog2):selenium binding

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.64344333227296
Log2 mRNA fold difference:0.045650679716319
Log2 TE fold difference:0.47358827436898
Sequences
Protein sequence

MASKKVDGEGKGKAIANTRMLRSMDRKTRSDTKRDGSSSKLMKIESPEKKKRKTTKAKNV
GAAKKKVKKEEVAVKIEKEEEEDDDAAEKEEDDDSDKKKIVIEHCKQCKSFKERANEVKE
GLEEAVPGIIVTVNPDKPRRGCFEIREEGGETFISLLAMKRPFTPMKELNMEEVIADIVE
KIK

MPPKKSKADGEEKAKPLTTLASSRVTRSMDSRTRSQTQQNGAKAAGSATKPATKKAKRKN
SAIETGRAKKGKKEEEVEEPEEAVEEEVEKEEPEVEDPTRTKIVIEHCKQCNAFKTRAIQ
VKEALEGAVPGVTVSLNPEKPRRGCFEIREEGGQTFISLLEMKRPFAPMKALDMEEVIED
IIKKVK

Other information
Ka divergence:0.0266756KaKs divergence:-0.0117025
GC content 1 (%):45GC content 2 (%):48GC content divergence:0.032
Length 1 (bp):552Length 2 (bp):561Length divergence:0.008
MFE 1 (kcal):-137.01MFE 2 (kcal):-152.6MFE divergence0.054