Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G24500-AT4G31420
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Zinc finger protein 622
Function (paralog2):Zinc finger protein 622

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.66234950513385
Log2 mRNA fold difference:-0.29311234994068
Log2 TE fold difference:-0.39488019570886
Sequences
Protein sequence

MSGLACNSCNKDFEDDAEQKFHYKSEWHRYNLKRKIAGVPGVTEALFEARQAAIAQEKVK
AVEAPMLYSCGICNKGYRSSKAHEQHLKSKSHVLKASTSTGEEDKAIIKQLPPRRVEKNN
TAQLKGSIEEEESEDEWIEVDSDEDLDAEMNEDGEEEDMDEDGIEFELDPACCLMCDKKH
KTIEKCMVHMHKFHGFFIPDIEYLKDPKGFLTYLGLKVKRDFVCLYCNELCHPFSSLEAV
RKHMDAKGHCKVHYGDGGDEEDAELEEFYDYSSSYVNGDENQMVVSGESVNTVELFGGSE
LVITKRTDNKVTSRTLGSREFMRYYKQKPAPSSQKHIVNSLTSRYKMMGLATVQSKEAIV
RMKVMREMNKRGAKSSVRLGMKSNVIRNLPNNVTY

MPGLTCNACNMEFKDEEERNLHYKSDWHRYNLKRKVAGVPGVTEALFEARQSALAQEKNK
SNEAPMLYTCAICAKGYRSSKAHEQHLQSRSHVLRVSQGTSINGEEDIAIIRQLPRRVQH
RGSIDDDSEDEWVEVDSDEELAAEEASDSLSKLNVNESGSAEDMDDDGDADKYELDPTCC
LMCDKKHKTLESCMLHMHKHHGFFIPDIEYLKDPEGLLTYLGLKVKRDFMCLYCNELCRP
FSSLEAVRKHMEAKSHCKLHYGDGDDEEDAELEEFYDYSSSSYVDEAGKQIVVSGETDNT
VELVGGSELLITEKSENTTTSKTLGSREFMRYYRQKPRPTSQDSNQIIASLSSRYKSLGL
KTVPSKEETLRMKVRKEMSKRGETMRTKIGVKSNVIRNLPNNVPY

Other information
Ka divergence:-0.156035KaKs divergence:0
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1188Length 2 (bp):1218Length divergence:0.012
MFE 1 (kcal):-361.8MFE 2 (kcal):-376.74MFE divergence0.02