Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G24530-AT4G31440
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.38880836091086
Log2 mRNA fold difference:0.46680666679395
Log2 TE fold difference:-0.25908332711013
Sequences
Protein sequence

MQRSQDQRISLCELKEHIVKKTGVERSRRYFYYLGRFLSQKLTKSEFDKTCLRLLGRENL
SLHNQLIRSILRNATVAKSPPPDHEAGHSTKANAFQSRGDGLEQSGTLIPNHSQHEPVWS
NGVLPISPRKVRSGMQNRKSRDRPSPLGSNGKVEHMLHQPVCREDNRGSVGMENGDYQRS
GRYVADEKDGEFLRPVEKPRIPNKEKIAAVSMRDDQNQEEQARVNLSMSPLIAPLGIPFC
SASVGGSPRTIPVSTNAELISCYDSGGLPDIEMLRKRMENIAVAQGLEGVSMECAKTLNN
MLDVYLKKLINSCFDLVGARSTNGDPGKQRIGKQQSQNKIVNGVWPTNSLKIQTPNGSSD
IRQDHHSVSMLDFRTAMELNPRQLGEDWPTLRERISLRSFEEQDFEV

MQRLQDPRIDLAELKVHIVKKVGVERSTRYFYYLGRFLSQKLTKSEFDKSCFRLLGRENL
SLHNKLIRSILRNASLAKSPPSVHQSGHPGKSLVLGKEDGPEESRSLNPDHIRNDLALSN
GVLAKVRPGTCDDRTIRDKPCPLGSNGKVLGPFAYSRPGRYPDERDSAFLCPAEQKAVSG
KDQVAAPISRDDEAQVRILSTPPVMAPLGIPFCSASVGGDRRTVPVSTSAAAISCYDSGG
LSDTEMLRKRMENIAVTQGLGGVSAECSIVLNNMLDLYLKKLMKSCVDLAGARSMNGTPG
KHSLEKQQSRDELVNGVRTNNSFHIQTSNQPSDITREQHSVSLLDFRVAMELNPHQLGED
WPLLRERISISLFEEREGV

Other information
Ka divergence:0.107547KaKs divergence:0.208584
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):1224Length 2 (bp):1140Length divergence:-0.036
MFE 1 (kcal):-367.62MFE 2 (kcal):-344.26MFE divergence-0.033