Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G24550-AT4G31510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.5854357435047
Log2 mRNA fold difference:-1.2572690386444
Log2 TE fold difference:-0.31916144400713
Sequences
Protein sequence

MEVMVGSSFGIGMAAYVRDHRGVSAQDKAVQTALFLADESGRGGSQIGIGLRMSNNNNKS
PEESSDSSSSIGESSENEEEEEEDDAVSCQRGTLDSFSSSLEDSLPIKRGLSNHYVGKSK
SFGNLMEAASKAKDLEKVENPFNKRRRLVIANKLRRRGRSMSASNFYSWQNPNSMPLLAL
QEPNEEDHHIHNDDYEDDDGDGDDHRKIMMMMKNKKELMAQTRSCFCLSSLQEEDDGDGD
DDEDE

MEVLVGSTFRDRSSVTTHDQAVPASLSSRIGLRRCGRSPPPESSSSVGETSENEEDEDDA
VSSSQGRWLNSFSSSLEDSLPIKRGLSNHYIGKSKSFGNLMEASNTNDLVKVESPLNKRR
RLLIANKLRRRSSLSSFSIYTKINPNSMPLLALQESDNEDHKLNDDDDDDDSSSDDETSK
LKEKRMKMTNHRDFMVPQTKSCFSLTSFQDDDDR

www.000webhost.com

Other information
Ka divergence:0.00406096KaKs divergence:-0.347731
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):738Length 2 (bp):645Length divergence:-0.067
MFE 1 (kcal):-206.1MFE 2 (kcal):-188.6MFE divergence-0.044