Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G24570-AT4G31550
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):WRKY DNA-binding protein 17
Function (paralog2):WRKY DNA-binding protein 11

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.0833013398819
Log2 mRNA fold difference:1.2581918576901
Log2 TE fold difference:-0.18150442427366
Sequences
Protein sequence

MTVDIMRLPKMEDQTAIQEAASQGLKSMEHLIRVLSNRPEERNVDCSEITDFTVSKFKKV
ISLLNRSGHARFRRGPVHSPPSSSVPPPVKVTTPAPTQISAPAPVSFVQANQQSVTLDFT
RPSVFGAKTKSSEVVEFAKESFSVSSNSSFMSSAITGDGSVSKGSSIFLAPAPAVPVTSS
GKPPLSGLPYRKRCFEHDHSEGFSGKISGSGNGKCHCKKSRKNRMKRTVRVPAVSAKIAD
IPPDEYSWRKYGQKPIKGSPHPRGYYKCSTFRGCPARKHVERALDDSTMLIVTYEGEHRH
HQSTMQEHVTPSVSGLVFGSA

MAVDLMRFPKIDDQTAIQEAASQGLQSMEHLIRVLSNRPEQQHNVDCSEITDFTVSKFKT
VISLLNRTGHARFRRGPVHSTSSAASQKLQSQIVKNTQPEAPIVRTTTNHPQIVPPPSSV
TLDFSKPSIFGTKAKSAELEFSKENFSVSLNSSFMSSAITGDGSVSNGKIFLASAPLQPV
NSSGKPPLAGHPYRKRCLEHEHSESFSGKVSGSAYGKCHCKKSRKNRMKRTVRVPAISAK
IADIPPDEYSWRKYGQKPIKGSPHPRGYYKCSTFRGCPARKHVERALDDPAMLIVTYEGE
HRHNQSAMQENISSSGINDLVFASA

Other information
Ka divergence:0.0267772KaKs divergence:0.341619
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):966Length 2 (bp):978Length divergence:0.006
MFE 1 (kcal):-301.3MFE 2 (kcal):-281.73MFE divergence-0.034