Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G24590-AT4G31580
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RNA recognition motif and CCHC-type zinc finger domains containing protein
Function (paralog2):serine/arginine-rich 22

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.84242853987559
Log2 mRNA fold difference:0.48904932853102
Log2 TE fold difference:0.33514249262982
Sequences
Protein sequence

MSRVYVGNLDPRVTERELEDEFRSFGVIRSVWVARRPPGYAFLDFEDSRDARDAIREVDG
KNGWRVEQSHNRGGGGGRGGGRGGGDGGRGRGGSDLKCYECGESGHFARECRSRGGSGGR
RRSRSRSRSPPRYRKSPTYGGRRSYSPRARSPPPPRRRSPSPRGRNYSRSPPPYRARDEV
PYANGNGLKDVRRSRS

MSRVYVGNLDPRVTERELEDEFRAFGVVRSVWVARRPPGYAFLDFEDPRDARDAIRALDG
KNGWRVEQSHNRGERGGGGRGGDRGGGGGGRGGRGGSDLKCYECGETGHFARECRNRGGT
GRRRSKSRSRTPPRYRRSPSYGRRSYSPRARSPPPPRRRSPSPPPARGRSYSRSPPPYRA
REEVPYANGNGLKERRRSRS

www.000webhost.com

Other information
Ka divergence:-0.0633429KaKs divergence:-0.0176678
GC content 1 (%):52GC content 2 (%):55GC content divergence:0.028
Length 1 (bp):591Length 2 (bp):603Length divergence:0.01
MFE 1 (kcal):-216.37MFE 2 (kcal):-211.6MFE divergence-0.011