Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G24630-AT4G31590
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Glycosyl transferase family 2 protein
Function (paralog2):Cellulose-synthase-like C5

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.225408216235
Log2 mRNA fold difference:2.0875254402046
Log2 TE fold difference:0.0033157763259464
Sequences
Protein sequence

MAPRFDFSDLWAKETRRGTPVVVKMENPNYSIVEVEEPDSAFQPMEKSRGKNAKQVTWVL
LLKAHKAVGCLTWVATVFWSLLGSVKRRLSFTHPLGSERLGRDGWLFSAIKLFLVASLAI
LAFELVAYYRGWHYFKNPNLHIPTSKLEIQSLLHLFYVGWLSLRADYIAPPIKALSKFCI
VLFLVQSVDRLILCLGCLWIKFKKIKPRIDEEHFRNDDFEGSGSEYPMVLVQIPMCNERE
VYEQSISAVCQLDWPKDRLLVQVLDDSDDESIQELIRDEVTKWSQKGVNIIYRHRLVRTG
YKAGNLKSAMSCDYVEAYEFVAIFDADFQPNSDFLKLTVPHFKEKPELGLVQARWAFVNK
DENLLTRLQNINLCFHFEVEQQVNGVFLNFFGFNGTAGVWRIKALEESGGWLERTTVEDM
DIAVRAHLHGWKFIYLNDVKVLCEVPESYEAYKKQQHRWHSGPMQLFRLCLRSILTSKIA
MWKKANLILLFFLLRKLILPFYSFTLFCVILPITMFVPEAELPIWVICYVPIFMSLLNIL
PAPKSFPFIVPYLLFENTMSVTKFNAMVSGLFQLGSSYEWIVTKKAGRSSESDLLALTDK
ESEKMPNQILRGVSDSELLEISQVEEQKKQPVSVKKTNKIFHKELALAFLLLTAAVRSLL
ASQGVHFYFLLFQGLTFLLVGLDLIGEQMS

MAPRLDFSDWWAKDTRKGTPVVVKMENPNYSVVEIDGPDSAFRPVEKSRGKNAKQVTWVL
LLKAHRAVGCLTWLATVFWSLLGAIKKRLSFTHPLGSEKLGRDRWLFTAIKLFLAVSLVI
LGFEIVAYFRGWHYFQSPSLHIPTSTLEIQSLFHLVYVGWLTLRADYIAPPIKALSKFCI
VLFLIQSVDRLVLCLGCFWIKYKKIKPRFDEEPFRNDDAEGSGSEYPMVLVQIPMCNERE
VYEQSISAVCQLDWPKDRILVQVLDDSNDESIQQLIKAEVAKWSQKGVNIIYRHRLVRTG
YKAGNLKSAMSCDYVEAYEYVAIFDADFQPTPDFLKLTVPHFKDNPELGLVQARWTFVNK
DENLLTRLQNINLCFHFEVEQQVNGVFLNFFGFNGTAGVWRIKALEESGGWLERTTVEDM
DIAVRAHLHGWKFIYLNDVKVLCEVPESYEAYKKQQHRWHSGPMQLFRLCLGSILTSKIA
IWKKANLILLFFLLRKLILPFYSFTLFCIILPLTMFVPEAELPVWVICYIPVFMSFLNLL
PSPKSFPFIVPYLLFENTMSVTKFNAMVSGLFQLGSSYEWIVTKKAGRSSESDLLSITEK
ETPTKKSQLLRGVSDSELLELSQLEEQKQAVSKKPVKKTNKIYHKELALAFLLLTAALRS
LLAAQGVHFYFLLFQGVTFLLVGLDLIGEQMS

Other information
Ka divergence:-0.126308KaKs divergence:-0.390392
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):2073Length 2 (bp):2079Length divergence:0.001
MFE 1 (kcal):-629.02MFE 2 (kcal):-635.62MFE divergence0.005