Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G24640-AT4G31670
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ubiquitin-specific protease 19
Function (paralog2):ubiquitin-specific protease 18

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.037685048559507
Log2 mRNA fold difference:0.052855293032042
Log2 TE fold difference:-0.052635930098189
Sequences
Protein sequence

MHEVGLFVDLNSFTQLILTLFFVSIGLLYFVKRTAAKYFEVGGGSGGFDRDHRRDFMVSD
TAECSVCGKATTKKCSRCKSVRYCSAACQTSDWKSGHKLKCKGFRSTDSSPVRRDDIDFE
ASLFGNRSASKKTRIALVPQQSQSKATLKPTDVLFPYESFVRYYNWDRPIMAPCGLTNCG
NSCFANVVLQCLSWTRPLVAYLLERGHKRECRRNDWCFLCEFENHLDRANYSRFPFSPMN
IISRLPNIGGNLGYGRQEDAHELMRFAIDMMQSVCLDEFGGEKVVPPRAQETTLIQYIFG
GLLQSQVQCTACSNVSDQYENMMDLTVEIHGDAVSLEECLDQFTAKEWLQGDNLYKCDRC
DDYVKACKRLSIRCAPNILTIALKRFQGGRFGKLNKRISFPETFDLGPYMSGGGEGSDVY
KLYAVIVHLDMLNASFFGHYICYVKDFRGNWYRIDDSEVEKVELEDVLSQRAYMLLYSRV
QPRPSNLRSEESQDEKKTDTLNTESNQDGSVESSGVGTNDTSVSSLCNGIISHSEDPEYE
KESSLSASVPVSEEGKEVDVKVDTVDSESNRSIDMEHDSGTDHQEEEANGKEDPTVENLA
VDSSCLDITTPSPSAATEFIPQENERSDTESKPLEKEHSDTESNKPLEKEHLDSESKPLE
KEHSDTEMIDAQ

MHEVGFPLDLSVFTRLIATLFFLAVGVFYFLKNTAAKYFDIGAAAAGGFDRDFMAVDAED
CSVCGNFSTKKCSRCKSVRYCSAECQRSDWSSGHQRNCRDYGITTLTPSAKNGLRFRASP
FGDSSASSIALISERGQNKSSLKPREVLFPYEEFVEYFNWDNPELAPCGLMNCGNSCFAN
VILQCLSWTRPLVAYLLEKGHKRECMRNDWCFLCEFQTHVERASQSRFPFSPMNIISRLT
NIGGTLGYGRQEDAHEFMRYAIDMMQSVCLDEFGGEKIVPPRSQETTLIQYIFGGLLQSQ
VQCTVCNHVSDQYENMMDLIVEMHGDAGSLEECLDQFTAEEWLHGDNMYKCDRCSDYVKA
CKRLTIRRAPNILTIALKRYQGGRYGKLNKRISFPETLDLNPYMSEGGDGSDVYKLYAVI
VHLDMLNASFFGHYICYIKDFCGNWYRIDDSEIESVELEDVLSQRAYMLLYSRIQARSSS
SCLRSEVKDEKKTDTLDTESCVKELVESSMVGAIESRSSTHATIEDPVCEQSPSPSPSPS
PSPSPSPSPSVLASECCSEVERIDTLDSESNSSIDDSATDHQEDVANGNKDPEVKYQAAD
SWSDPTTSTPLVCTKSKPPVRDMDTKMIDAQ

Other information
Ka divergence:0.036711KaKs divergence:0.515825
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):2019Length 2 (bp):1896Length divergence:-0.031
MFE 1 (kcal):-613.06MFE 2 (kcal):-565.58MFE divergence-0.04