Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G24762-AT4G31730
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):glutamine dumper 4
Function (paralog2):glutamine dumper 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-3.5186977932228
Log2 mRNA fold difference:-3.3135790269671
Log2 TE fold difference:0.24251896388412
Sequences
Protein sequence

MRPLSIKPTSLDVARHATSVESFGNHRPPISPWHSPVPYLFGGLAAMLGLIAFALLILAC
SYWRLSTSGDDSGERVDEEKESRSGVKAASAACEEKVLVIMAGDDLPRFLATPAANKCMC
GHEGRMVIFKEDGIGAGEEKMGDREKAKENEETTSQ

MRPLSVQSKFEDVATSTSVNHHGVTPQSPWHSPVPYLFGGLAAMLGLIAFALLILACSYW
RLSSSGEEDGQNVDEEKESRSGDKAANGAYEEKFLVIMAGEDLPRYLATPAMKKCTCGGH
EGKMVISQEESVAKEEEKMREGEEEKVKDTGETTTTSH

Other information
Ka divergence:-0.262303KaKs divergence:0.582114
GC content 1 (%):52GC content 2 (%):50GC content divergence:-0.02
Length 1 (bp):471Length 2 (bp):477Length divergence:0.006
MFE 1 (kcal):-160.1MFE 2 (kcal):-164.65MFE divergence0.014